Recombinant Rat Chloride intracellular channel protein 5 (Clic5)

Shipped with Ice Packs
In Stock

Description

Research Applications

The recombinant protein is utilized in diverse studies to elucidate Clic5’s physiological and pathological roles:

3.1. Cytoskeletal and Membrane Dynamics

  • Actin-ERM Interactions: CLIC5 binds ezrin and radixin, stabilizing actin-membrane linkages in hair cell stereocilia and podocytes .

  • Membrane Fusion: Purified CLIC5 induces liposome fusion via hydrophobic domain exposure, critical for organelle dynamics .

3.2. Tissue-Specific Functions

Tissue/ProcessFindings with Recombinant Clic5Source
Kidney GlomeruliRequired for podocyte foot process formation; deficiency causes filtration barrier defects .
Inner EarAssociates with stereocilia; loss leads to hearing loss and vestibular dysfunction .
Skeletal MusclePromotes myoblast differentiation via Wnt/β-catenin signaling; regulates satellite cell proliferation .
Cilia FormationClic5b isoform localizes to cilia; knockdown disrupts Wnt signaling and causes ciliopathies .

3.3. Disease Modeling

  • Deafness: Mutations in CLIC5 linked to progressive hearing loss; recombinant protein aids in studying stereocilia degeneration .

  • Kidney Disease: CLIC5-deficient models exhibit glomerular endothelial cell vacuolization, mimicking human nephropathies .

4.1. Mechanistic Insights

  • Wnt Signaling Regulation: CLIC5 activates Ezrin/Radixin/Moesin (ERM) proteins, enhancing Wnt/β-catenin activity in muscle and cilia .

  • Phosphoinositide Modulation: CLIC5A induces PI(4,5)P₂ production, stabilizing podocyte architecture .

4.2. Membrane Fusion Activity

  • In Vitro Assays: CLIC5 promotes liposomal fusion under acidic pH, mediated by hydrophobic domain interactions .

  • Structural Basis: X-ray crystallography reveals flexibility in the inter-domain interface, enabling membrane interaction .

Challenges and Future Directions

  • Functional Redundancy: Overlapping roles with CLIC1/CLIC4 necessitate isoform-specific studies .

  • Therapeutic Potential: Targeting CLIC5 for ciliopathies or muscle dystrophies requires deeper mechanistic understanding .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Clic5; Chloride intracellular channel protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Clic5
Target Protein Sequence
MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKP ADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAARHRESNTAGIDIFS KFSAYIKNTKQQNNAALERGLTKALRKLDDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDE LTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELA YADVARRLSRS
Uniprot No.

Target Background

Function
Chloride intracellular channel protein 5 (Clic5) is essential for normal hearing, playing a crucial role in stereocilia formation within the inner ear and the proper development of the organ of Corti. Clic5 inserts into cell membranes, forming ion channels with low selectivity, potentially transporting chloride ions. It may also regulate transepithelial ion absorption and secretion. Furthermore, Clic5 is necessary for the development and maintenance of glomerular endothelial cell and podocyte architecture, and it contributes to lens suture formation in the eye, vital for maintaining the lens' optical properties.
Database Links

KEGG: rno:94272

STRING: 10116.ENSRNOP00000067890

UniGene: Rn.1838

Protein Families
Chloride channel CLIC family
Subcellular Location
Golgi apparatus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Membrane; Single-pass membrane protein. Apical cell membrane; Single-pass membrane protein. Cytoplasm.
Tissue Specificity
Detected in cochlea, in cochlear and vestibular hair cell bundles in the organ of Corti (at protein level).

Q&A

What is the fundamental role of CLIC5 in skeletal muscle development?

CLIC5 functions as a key regulator in skeletal muscle development through its ability to promote myoblast differentiation while inhibiting proliferation. It mediates the balance between myoblast proliferation and differentiation, which is essential for proper muscle formation and maintenance. Studies using CLIC5-knockdown myoblasts show shorter myosin-positive myotubes with fewer nuclei and significantly reduced differentiation and fusion indices compared to controls . At the molecular level, CLIC5 activates the canonical Wnt/β-catenin signaling pathway, which is crucial for myogenic differentiation. This activation leads to the expression of myogenic regulatory factors required for muscle development and regeneration .

How does CLIC5 expression vary across different tissues?

CLIC5 expression varies significantly across tissue types, with notable expression in skeletal muscle tissues. In conditional knockout studies, significant reduction in CLIC5 expression was observed in the tibialis anterior (TA), extensor digitorum longus, and gastrocnemius (GAS) muscles, while no significant changes were observed in the soleus, epididymal white adipose tissue, inguinal white adipose tissue, liver, and spleen . Interestingly, CLIC5 mRNA was expressed at only low levels in the stomach, contrary to earlier hypotheses about its role in gastric acid secretion . This tissue-specific expression pattern suggests specialized functions in skeletal muscle that may not extend to all tissue types.

What phenotypic changes are observed in CLIC5 knockout models?

CLIC5 knockout models exhibit several distinct phenotypic changes:

  • Reduced body weight (9.67% reduction in male mice and 5.55% in female mice at 9 weeks of age)

  • Decreased muscle mass, particularly in the tibialis anterior and gastrocnemius muscles

  • Resistance to diet-induced obesity

  • Hyperactivity and hyperphagia (increased food intake)

  • Increased susceptibility to fasting-induced gastric hemorrhaging

  • Reduced monocytes and granulocytes, suggesting immune dysfunction

  • Behavioral and social disorders indicating potential neurological dysfunction

These phenotypic changes highlight CLIC5's multifaceted role in development, metabolism, and possibly immune and neurological function.

How does CLIC5 interact with the Wnt/β-catenin signaling pathway in muscle development?

CLIC5 activates the canonical Wnt/β-catenin signaling pathway, which is critical for proper muscle development and regeneration. Research has revealed that CLIC5 deficiency significantly impairs this pathway's activity. RNA sequencing analysis of wild-type and CLIC5 knockout myoblasts identified significantly enriched pathways affected by CLIC5 loss, including the Wnt signaling pathway (q = 0.034), Hippo signaling pathway (q < 0.01), ubiquitin-mediated proteolysis (q < 0.01), and phosphatidylinositol 3-kinase–Akt signaling pathway (q = 0.011) .

In CLIC5-deficient myoblasts, the mRNA levels of key Wnt target genes, including nephrin (Nphs1), cell division cycle 25C (Cdc25c), fermitin family member 2 (Fermt2), c-Myc, and SRY-box transcription factor 9 (Sox9), were significantly decreased (P < 0.01) . Conversely, CLIC5-overexpressing myoblasts showed increased levels of key components in the canonical Wnt/β-catenin pathway and elevated mRNA levels of Wnt target genes . Treatment with the Wnt activator BML-284 significantly restored myotube formation and myosin expression in CLIC5-knockdown myoblasts, further confirming CLIC5's role in activating this pathway .

What are the implications of CLIC5 in muscle regeneration and repair?

CLIC5 plays a crucial role in skeletal muscle regeneration and repair. Studies utilizing CLIC5 conditional knockout mice (CLIC5 MKO) have demonstrated that CLIC5 deficiency significantly delays muscle regeneration following injury. Histological analysis revealed that three days post-injury, wild-type mice exhibited numerous newly formed myofibers with centrally located nuclei, while CLIC5 MKO mice showed minimal muscle fiber regeneration .

At the molecular level, CLIC5 deficiency leads to reduced protein levels of Pax7 and Myogenin (MyoG) at day 3 post-injury compared to wild-type mice (P < 0.05), indicating a reduction in the number and differentiation potential of muscle satellite cells (MuSCs) . Additionally, the expression levels of biglycan (BGN) and the activity of the canonical Wnt/β-catenin signaling pathway were significantly reduced in tibialis anterior muscles of CLIC5 MKO mice at day 3 post-injury (P < 0.05 and P < 0.01) . This suggests that CLIC5 deficiency delays skeletal muscle regeneration through the BGN-mediated canonical Wnt/β-catenin signaling pathway.

How does CLIC5 influence systemic energy metabolism?

CLIC5 has emerged as a significant factor in systemic energy metabolism. Studies with CLIC5 mutant mice have revealed that they are hyperphagic (consume more food) yet remain smaller and leaner than their wild-type littermates . These mutant mice exhibit remarkable resistance to diet-induced obesity, suggesting CLIC5's important role in energy storage and utilization .

The metabolic phenotype observed in CLIC5 mutant mice appears to be related, at least in part, to their hyperactivity. Their impaired capacity for storing energy renders these mice more susceptible to fasting-induced gastric hemorrhaging and torpor . This suggests that CLIC5 may be involved in pathways that regulate energy expenditure, storage, and utilization, potentially through its interactions with signaling pathways that govern metabolic homeostasis.

What are the optimal approaches for generating CLIC5 knockout models?

Creating effective CLIC5 knockout models requires careful consideration of the targeting strategy and breeding approach. Based on recent research, the following methodologies have proven successful:

  • CRISPR-Cas9 genome editing: CLIC5 conditional knockout mice can be generated using the CRISPR-Cas9 system. This involves constructing a targeting vector by inserting a flippase recombination target (Frt)-flanked neomycin cassette upstream and two loxP sites downstream of the second exon of CLIC5 .

  • Tissue-specific knockout: For skeletal muscle-specific CLIC5 knockout, researchers successfully crossed CLIC5-floxed mice with Myf5-Cre mice (available from Jackson Laboratory, catalog #J007893) . This approach allows for the study of CLIC5 function specifically in skeletal muscle while minimizing potential developmental compensation.

  • Genetic background considerations: When developing CLIC5 mutant mice, the genetic background significantly affects breeding efficiency. Initial CLIC5-/- mice on a C3H/HeJ background bred poorly with small litters (3 offspring or fewer). Backcrossing for one generation onto C57BL/6 improved breeding efficiency and litter sizes . Using sex-matched littermate controls helps minimize variability due to background effects.

  • Genotyping protocol: PCR genotyping of tail DNA can be performed by amplifying across the deletion mutation using appropriate primers .

What methodologies are effective for studying CLIC5's role in muscle differentiation?

Several methodologies have proven effective for investigating CLIC5's role in muscle differentiation:

  • Cell culture models: C2C12 myoblast cell lines provide an excellent in vitro model for studying CLIC5's effects on proliferation and differentiation. These cells can be subjected to CLIC5 knockdown using siRNA or overexpression using appropriate vectors .

  • Proliferation assays: EdU (5-ethynyl-2'-deoxyuridine) incorporation assay can be used to assess cell proliferation in CLIC5-modified myoblasts. Cell cycle analysis using flow cytometry provides additional information about cell cycle distribution .

  • Differentiation assessment: Immunofluorescence staining for myosin and calculation of differentiation and fusion indices provide quantitative measures of myogenic differentiation. The differentiation index is calculated as the percentage of myosin-positive nuclei among total nuclei, while the fusion index represents the percentage of nuclei in myosin-positive myotubes containing ≥3 nuclei among total nuclei .

  • Molecular analysis: Quantitative PCR (qPCR) for myogenic markers (Myf5, MyoD, MyoG, Myomaker) and Western blotting for protein expression (MyoG, myosin) help quantify the effects of CLIC5 modulation on differentiation at the molecular level .

How can researchers effectively isolate and analyze muscle satellite cells in CLIC5 studies?

Proper isolation and analysis of muscle satellite cells (MuSCs) are critical for studying CLIC5's role in muscle development and regeneration:

  • Fluorescence-activated cell sorting (FACS): MuSCs can be isolated using FACS-based methods. This approach has been used successfully to demonstrate that the proportion of MuSCs significantly decreases from 11.15% to 8.22% in the hind limbs of CLIC5 MKO mice compared to wild-type controls .

  • Ex vivo culture: Isolated MuSCs can be cultured ex vivo to study their proliferation and differentiation potential. This approach allows for the assessment of CLIC5's cell-autonomous effects on MuSC function .

  • Muscle injury models: Cardiotoxin (CTX) injection into the tibialis anterior muscle induces muscle injury and subsequent regeneration, providing an in vivo model to study CLIC5's role in muscle regeneration. Muscles can be harvested at specific timepoints post-injury (e.g., days 3, 7, and 14) for histological and molecular analyses .

  • Adeno-associated viral (AAV) vectors: For rescue experiments, serotype 9 recombinant AAV vectors can be generated to express CLIC5 or control constructs. Intramuscular injections of these vectors (typically at a dose of 3×1012vg) can be performed three weeks before inducing muscle injury to assess the effects of CLIC5 restoration .

How do researchers analyze the signaling pathways affected by CLIC5 modulation?

Analysis of signaling pathways affected by CLIC5 modulation requires a multi-faceted approach:

  • RNA sequencing: RNA-seq analysis of wild-type and CLIC5 knockout myoblasts can identify differentially expressed genes (DEGs). Genes with P < 0.05 and fold changes of ≥3 or ≤0.33 between samples are typically considered significant. Pathway enrichment analysis of these DEGs can reveal affected signaling pathways. For instance, RNA-seq analysis identified 171 up-regulated and 225 down-regulated genes in CLIC5 knockout myoblasts compared to wild-type controls .

  • Pathway validation: qPCR can be used to validate the expression changes of selected genes identified by RNA-seq. In CLIC5 studies, researchers selected 11 DEGs for validation to confirm RNA-seq accuracy .

  • Western blotting: Protein levels of key pathway components can be assessed using Western blotting. For the Wnt/β-catenin pathway, measuring the levels of phosphorylated and total β-catenin, as well as downstream targets, provides insights into pathway activity .

  • Pharmacological manipulations: Pathway activators or inhibitors can be used to test the functional relevance of identified pathways. For instance, treatment with the Wnt activator BML-284 significantly restored myotube formation and myosin expression in CLIC5-knockdown myoblasts, confirming the role of this pathway in mediating CLIC5's effects .

What are the key considerations when comparing wild-type and CLIC5 knockout phenotypes?

When comparing wild-type and CLIC5 knockout phenotypes, researchers should consider several important factors:

  • Genetic background effects: Even minor differences in genetic background can influence experimental outcomes. Using sex-matched littermate controls helps minimize variability due to background effects .

  • Developmental compensation: Complete knockout of CLIC5 from early development may lead to compensatory mechanisms that mask the protein's true functions. Conditional and inducible knockout systems help mitigate this issue .

  • Tissue-specific effects: CLIC5 functions may vary across tissues. In CLIC5 MKO mice, expression was significantly reduced in specific muscles (tibialis anterior, extensor digitorum longus, and gastrocnemius) but not in others (soleus) or non-muscle tissues . This highlights the importance of examining multiple tissues when characterizing phenotypes.

  • Knockdown efficiency: CLIC5 protein levels were reduced by 57.7% in tibialis anterior muscle and 87.5% in MuSCs in CLIC5 MKO mice. This incomplete knockdown means some cells escape CLIC5 deletion, which may contribute to phenotypic rescue during extended observations .

  • Sex differences: CLIC5 knockout resulted in a 9.67% reduction in body weight in male mice compared to a 5.55% reduction in female mice, indicating that phenotypic effects may be sex-dependent .

How can researchers interpret the metabolic phenotype in CLIC5-deficient models?

Interpreting the metabolic phenotype in CLIC5-deficient models requires consideration of several interconnected factors:

  • Energy balance assessment: The hyperphagia (increased food intake) but leaner phenotype of CLIC5 mutant mice suggests increased energy expenditure. Quantitative magnetic resonance imaging can be used to study body composition and track changes in fat and lean mass .

  • Activity monitoring: CLIC5 mutant mice exhibit hyperactivity, which likely contributes to their metabolic phenotype. Monitoring activity levels in controlled environments helps quantify this contribution .

  • Hormone profiling: Measuring plasma levels of various hormones, glucose, and lipids provides insights into the metabolic state of CLIC5-deficient animals .

  • Challenge tests: Subjecting animals to metabolic challenges such as high-fat diets or fasting reveals how CLIC5 deficiency affects adaptability to different nutritional states. CLIC5 mutant mice show remarkable resistance to diet-induced obesity and increased susceptibility to fasting-induced complications .

  • Multi-tissue analysis: The metabolic phenotype likely involves interactions between multiple tissues. CLIC5's role in muscle, which is a major site of energy expenditure, may have systemic effects on metabolism. Examining multiple tissues helps construct a comprehensive picture of the metabolic phenotype .

What are common challenges in CLIC5 knockout model generation and how can they be addressed?

Researchers working with CLIC5 knockout models often encounter several challenges:

  • Poor breeding efficiency: CLIC5-/- mice on the original C3H/HeJ background bred very poorly with small litters (3 offspring or fewer). This can be addressed by backcrossing onto a more robust background such as C57BL/6, which has been shown to improve breeding efficiency and litter sizes .

  • Incomplete knockout: In conditional knockout models, complete elimination of the target protein is rarely achieved. For example, CLIC5 protein levels were reduced by 57.7% in tibialis anterior muscle and 87.5% in MuSCs in CLIC5 MKO mice . This issue can be addressed by:

    • Using multiple Cre lines to improve deletion efficiency

    • Validating knockout efficiency in each experimental tissue

    • Considering the presence of "escapers" when interpreting results

  • Compensatory mechanisms: Other CLIC family members might compensate for CLIC5 loss. In CLIC5 MKO mice, decreased CLIC3 expression was observed in the tibialis anterior muscle, although expression levels of other CLIC family members did not show significant differences . Researchers should measure expression of related family members to identify potential compensation.

  • Phenotypic variability: Even on similar genetic backgrounds, phenotypic variability can occur. Using sex-matched littermate controls and sufficiently large sample sizes helps account for this variability .

What methodological limitations should researchers consider when studying CLIC5's role in muscle differentiation?

Several methodological limitations warrant consideration when studying CLIC5's role in muscle differentiation:

  • In vitro versus in vivo differences: Cell culture models may not fully recapitulate the complex environment of developing or regenerating muscle in vivo. Researchers should validate key findings using both approaches.

  • Knockdown versus knockout effects: Transient knockdown of CLIC5 using siRNA may produce different effects than stable genetic knockout, potentially due to differences in the timing and completeness of protein depletion. The inhibition of CLIC5 by the chloride channel ligand IAA94 (100 μM) produced similar but not identical effects to genetic knockdown, highlighting the importance of using multiple approaches .

  • Cell line considerations: Immortalized myoblast cell lines like C2C12 may behave differently from primary myoblasts or satellite cells. When possible, researchers should validate findings in primary cells.

  • Temporal dynamics: CLIC5's role may vary during different stages of differentiation. Time-course experiments with multiple sampling points provide more comprehensive insights than single-timepoint analyses.

  • Context-dependent effects: CLIC5's effects on muscle differentiation may depend on the cellular context and experimental conditions. For instance, while CLIC5 MKO mice showed delayed muscle regeneration initially, muscles were fully regenerated by day 14 post-injury, suggesting context-dependent effects or compensatory mechanisms .

How can researchers overcome challenges in interpreting conflicting data about CLIC5 function?

Interpreting conflicting data about CLIC5 function requires careful consideration and several strategies:

  • Model system differences: Conflicting results may arise from different model systems. For example, early hypotheses suggested CLIC5 played a major role in gastric acid secretion, but CLIC5 mutant mice exhibited only a minor reduction in acid secretion, and CLIC5 mRNA was expressed at only low levels in stomach . Researchers should consider how differences in species, cell types, or experimental conditions might influence results.

  • Temporal dynamics: CLIC5's function may vary temporally. In muscle regeneration studies, CLIC5 KO initially delayed regeneration, but muscles were fully regenerated by day 14, potentially at the expense of satellite cell self-renewal . Time-course experiments help identify such temporal variations.

  • Pathway interactions: CLIC5 affects multiple signaling pathways, including Wnt/β-catenin, Hippo, and PI3K-Akt . Seemingly conflicting phenotypes might result from differential effects on these interacting pathways under various conditions.

  • Genetic background effects: Even minor differences in genetic background can influence experimental outcomes. The CLIC5 phenotype was found to be robust even on a mixed background after backcrossing, but sex-matched littermate controls were used to minimize variability .

  • Independent validation: Validating key findings using independent approaches (e.g., genetic and pharmacological CLIC5 inhibition) increases confidence in the results. For example, both genetic CLIC5 knockdown and IAA94-mediated inhibition were shown to promote proliferation and inhibit differentiation of C2C12 myoblasts .

What are emerging areas of investigation for CLIC5 in muscle biology and metabolism?

Several promising research directions are emerging for CLIC5 in muscle biology and metabolism:

  • Aging and sarcopenia: Given CLIC5's role in muscle development and regeneration, investigating its contribution to age-related muscle loss (sarcopenia) represents an important research direction. The reduced pool of MuSCs in CLIC5 MKO mice suggests that CLIC5 deficiency might lead to regenerative defects during aging .

  • Exercise physiology: CLIC5's involvement in muscle development and energy metabolism makes it a candidate for studies on exercise adaptation. Research could explore how CLIC5 expression and activity change in response to different exercise modalities and training regimens.

  • Metabolic disorders: The resistance to diet-induced obesity observed in CLIC5 mutant mice suggests potential applications in metabolic disorder research . Studies could investigate whether modulating CLIC5 activity might provide therapeutic benefits in obesity or metabolic syndrome.

  • Muscle-specific isoforms: Investigating potential muscle-specific isoforms of CLIC5 and their differential functions could provide insights into tissue-specific roles and potential therapeutic targets.

  • Interaction with other signaling pathways: While CLIC5's interaction with the Wnt/β-catenin pathway has been established , its relationships with other signaling networks (Hippo, PI3K-Akt) warrant further investigation to develop a comprehensive understanding of CLIC5's regulatory functions.

How might CLIC5 research contribute to understanding muscle-related diseases and potential therapies?

CLIC5 research holds significant potential for understanding and treating muscle-related diseases:

  • Muscular dystrophies: CLIC5's role in muscle development and regeneration makes it relevant to muscular dystrophies characterized by impaired regenerative capacity. Understanding how CLIC5 regulates muscle regeneration could inform therapeutic strategies aimed at enhancing repair processes in dystrophic muscles.

  • Cachexia: Cancer- or disease-associated cachexia involves significant muscle wasting. Given CLIC5's role in maintaining muscle mass , investigating its potential dysregulation in cachexia could provide new therapeutic targets.

  • Metabolic myopathies: The metabolic phenotype observed in CLIC5 mutant mice suggests that CLIC5 may be involved in the intersection between muscle function and metabolism. This could be relevant for understanding metabolic myopathies characterized by abnormal energy utilization in muscle.

  • Gene therapy approaches: The successful use of adeno-associated viral (AAV) vectors to deliver CLIC5 in mouse models lays groundwork for potential gene therapy approaches targeting CLIC5 in muscle diseases.

  • Drug development: Understanding CLIC5's role in activating the Wnt/β-catenin signaling pathway could inform the development of drugs that modulate this pathway in muscle cells. The finding that the Wnt activator BML-284 restored myotube formation in CLIC5-knockdown myoblasts suggests that pharmacological manipulation of this pathway might compensate for CLIC5 deficiency.

What technological advances might enhance future studies of CLIC5 function?

Several technological advances hold promise for enhancing future CLIC5 studies:

  • Single-cell transcriptomics: This technology would allow researchers to characterize heterogeneity within muscle satellite cell populations and identify cell-specific responses to CLIC5 modulation. This could help explain the apparently contradictory findings that CLIC5 MKO mice show delayed initial muscle regeneration but achieve complete regeneration by day 14 post-injury .

  • CRISPR-Cas9 base editing and prime editing: These advanced gene editing technologies offer more precise control over CLIC5 modifications, enabling the study of specific domains or residues without completely abolishing protein expression.

  • In vivo imaging techniques: Advanced in vivo imaging would allow real-time monitoring of muscle regeneration processes in CLIC5-deficient models, providing dynamic information about cellular behaviors and signaling activities.

  • Tissue-specific inducible knockout systems: More sophisticated inducible knockout systems would enable temporal control over CLIC5 deletion, allowing researchers to distinguish between developmental and adult-specific functions and avoid compensatory mechanisms that might occur during development.

  • Proteomics approaches: Advanced proteomics techniques could identify CLIC5 interacting partners in muscle cells, providing insights into its molecular mechanisms of action. This would complement current knowledge about CLIC5's effects on signaling pathways and help construct a more comprehensive model of its function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.