Recombinant Rat Chloride intracellular channel protein 6 (Clic6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Clic6; Clic6b; Chloride intracellular channel protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-612
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Clic6
Target Protein Sequence
MAEATEPKEVSSGSQGQPEGAVIEGPGEPGAADLEGREASEGAAEAPRDLGEGAEAMASG KEEGGCGQDGEIGEVQAQDPRPGPGTETPGTSGAPGEAEAAECDSEGALIPQSGGGAKRQ QVQGTSSGLDAQGEAPEVPEDARREPEDPKASEAGEEAESGQEALGGSAPESQINPEVQG PVGDNMDTEAPAGEPQGSEGEPQGGGESSPQPQDEAIEIAAAEVGGHEPGELAGASAADA KGEGETLRKDGFEEAAPEEARVDSGENGFEEAAPEEARVDSGENRDQGRLQEETGEEEAR PESGLKGPCEEAIQEKAPDGSLDGEEAKSTGHEESQVELSNHLAEETSAQGGEELGRVNG RRENGPASEEGDLGQEHDITLFVKAGSDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLK RKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGND VFAKFSAFIKNTKKDANDIYEKNLLRALKKLDSYLNSPLPDEIDAYSTEDVTVSQRKFLD GDELTLADCNLLPKLHIIKIVAKKYRGFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEI EHAYSDAAKRMK
Uniprot No.

Target Background

Function
This protein inserts into cell membranes to form chloride ion channels. It may play a critical role in water-secreting cells, potentially through the regulation of chloride ion transport.
Database Links
Protein Families
Chloride channel CLIC family
Subcellular Location
Cytoplasm. Cell membrane; Single-pass membrane protein.
Tissue Specificity
Predominantly expressed in brain, pituitary and stomach. In adult brain, it is restricted to the choroid plexus, the striatal proliferative subventricular zone and the cerebellum where it colocalizes with the D(3)R in the Purkinje cells of the lobules IX

Q&A

What is CLIC6 and what distinguishes it from other chloride channel proteins?

CLIC6 (Chloride intracellular channel protein 6) belongs to the CLIC family of proteins that exist in both soluble and transmembrane forms. It is implicated in breast, ovarian, lung, gastric, and pancreatic cancers and interacts with dopamine-(D2-like) receptors. While its soluble structure has been resolved, the membrane structure remains unknown. Unlike conventional ion channels, CLIC6 transitions between soluble and membrane-integrated forms, allowing it to function as an anion channel with preferential chloride conductance . CLIC6 is also known as CLIC1L and chloride channel form A . In rats, it may also be referred to as Clic6b .

What is known about CLIC6 tissue distribution and expression patterns?

Quantitative RT-PCR analysis has demonstrated that CLIC6 is most abundant in lung and brain tissues compared to other organs. This finding has been confirmed functionally, with CLIC6 currents successfully recorded in mouse lung epithelial (MLE) cells . These cells exhibit chloride currents with sensitivity to IAA-94 (a CLIC-specific blocker), which is consistent with functional CLIC6 expression. Control experiments in MLE cells lacking CLIC6 showed chloride currents that were not sensitive to IAA-94, confirming the specificity of the observed CLIC6 activity .

How is recombinant CLIC6 typically prepared and stored for experimental use?

Recombinant rat CLIC6 is commonly expressed in E. coli expression systems and supplied in liquid form containing glycerol . For optimal stability, the protein should be stored at -20°C, with extended storage at either -20°C or -80°C. Repeated freezing and thawing cycles should be avoided as they can compromise protein integrity. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week . This storage protocol ensures maintenance of protein structure and function for experimental applications.

What expression systems are most effective for studying CLIC6 function?

HEK-293 cells have proven to be an effective heterologous expression system for studying CLIC6. When transfected into these cells, CLIC6 successfully localizes to the plasma membrane, as confirmed by colocalization with wheat germ agglutinin, a plasma membrane marker . This localization enables functional characterization using electrophysiological approaches. The transfection efficiency can be monitored using co-expressed fluorescent markers like GFP or by using epitope-tagged versions of CLIC6 (e.g., FLAG-tagged) that can be detected with specific antibodies .

What electrophysiological approaches are most suitable for characterizing CLIC6?

Both traditional patch-clamp and automated patch-clamp approaches have been successfully employed to characterize CLIC6. For whole-cell recordings, NMDG-Cl solutions (130-135 mM) are recommended to isolate chloride currents . Voltage step protocols from -100 mV to +100 mV effectively reveal CLIC6's voltage-dependent properties. For single-channel recordings, the cell-attached configuration with 130 mM chloride in the pipette and 4.2 mM in the cytoplasm at holding potentials of +100 mV and -100 mV can reveal distinct channel substates . The automated SyncroPatch 384i system has also been validated for high-throughput CLIC6 current recordings .

How can researchers distinguish CLIC6-specific currents from endogenous chloride currents?

Several approaches can be employed to differentiate CLIC6 currents from endogenous chloride currents:

  • Pharmacological profile: CLIC6 currents are inhibited by IAA-94 (10 μM), which blocks approximately 48±5% of peak current at +100 mV in whole-cell configuration .

  • Voltage dependence: CLIC6 exhibits characteristic voltage-dependent gating (V1/2 = 14.062 mV) with enhanced activity at positive potentials .

  • Control experiments: Comparing currents in CLIC6-transfected cells with non-transfected cells under identical recording conditions .

  • Single-channel properties: CLIC6 displays distinct substates in addition to a main conductance level .

What is the ion selectivity profile of CLIC6?

CLIC6 demonstrates clear anion selectivity with a preference hierarchy of Cl- >> Br- = F-. This selectivity has been established through ion substitution experiments in whole-cell patch-clamp recordings . When chloride (NMDG-Cl, 135 mM) is replaced with bromide (NMDG-Br) or fluoride (NMDG-F), a significant decrease in whole-cell currents is observed. The reversal potential for chloride is -40 mV, shifting to -60 mV when replaced with bromide or fluoride . While CLIC6 does permit some potassium conductance (tested with KCl solutions), this is substantially lower than its chloride conductance, and the current is effectively eliminated when using potassium methyl sulfate (KMeSO4) .

How is CLIC6 function regulated by pH?

CLIC6 function shows pH-dependent modulation. When pH is reduced from 7.2 to 6.2, a slight (though not statistically significant) decrease in current density is observed . Interestingly, while IAA-94 (10 μM) effectively blocks CLIC6 currents at pH 7.2, this block is significantly reduced at pH 6.2 . This pH-dependent behavior is mediated by histidine residue 648 (H648) in the C-terminus. When H648 is mutated to alanine (H648A), the channel shows significantly reduced current density, and the differential response to pH is abolished . Additionally, the H648A mutant loses sensitivity to IAA-94 blockade, suggesting that this residue is critical for both pH sensing and inhibitor binding .

What role does redox regulation play in CLIC6 function?

CLIC6 is regulated by redox conditions, with reducing agents affecting channel activity. The application of dithiothreitol (DTT, a reducing agent) decreases CLIC6 activity . This redox sensitivity is mediated by cysteine residue 487 (C487) in the N-terminus, which aligns with cysteine 24 in CLIC1, a known redox sensor in that protein . Mutation of C487 to alanine (C487A) significantly reduces CLIC6 activity and eliminates the response to DTT, confirming this residue's direct involvement in redox regulation . This mechanism allows CLIC6 to respond to cellular redox state changes, potentially linking its function to oxidative stress conditions.

What are the voltage-dependent properties of CLIC6?

CLIC6 exhibits pronounced voltage-dependent characteristics with the following key parameters:

ParameterValueMeasurement Conditions
V1/2 (midpoint of activation)14.062 mVNMDG-Cl solutions, whole-cell configuration
Reversal potential (Er)-40 mV135 mM NMDG-Cl (bath), 130 mM NMDG-Cl (pipette)
Gating behaviorFast voltage-dependent gatingCloses at negative voltages, opens at positive voltages
IAA-94 block at +100 mV48 ± 5% inhibition10 μM IAA-94, whole-cell configuration
Single-channel Po reduction with IAA-9453 ± 4% (+100 mV), 51 ± 5% (-100 mV)10 μM IAA-94, cell-attached configuration

The channel demonstrates fast gating that closes at negative membrane voltages and opens upon depolarization to positive voltages . When the conductance (G) is plotted as a function of voltage and fitted to the Boltzmann equation, CLIC6 shows enhanced activity at positive holding potentials compared to negative potentials .

What single-channel properties characterize CLIC6?

In cell-attached recordings (with 130 mM chloride in the pipette and 4.2 mM in the cytoplasm), CLIC6 displays complex single-channel behavior with the following characteristics:

  • Multiple conductance states: Two distinct substates in addition to a main large conductance level .

  • Substate activity: A prominent substate at approximately 50% of the main opening level, similar to other CLIC proteins .

  • Pharmacological sensitivity: Open probability (Po) decreases by 53 ± 4% at +100 mV and 51 ± 5% at -100 mV upon addition of 10 μM IAA-94 .

  • Voltage sensitivity: Active at both positive and negative potentials, with distinct gating kinetics .

These properties distinguish CLIC6 from other chloride channels and provide important parameters for identification in native tissues.

How do CLIC6 mutations affect channel function and regulation?

Strategic mutations in CLIC6 have revealed key structural determinants of function:

MutationFunctional EffectRegulatory Impact
H648A (C-terminus)Reduced current densityAbolished pH sensitivity and IAA-94 block
C487A (N-terminus)Reduced channel activityEliminated DTT (redox) sensitivity

These mutations demonstrate that H648 is critical for both pH sensing and inhibitor binding, while C487 serves as the primary redox sensor . The conservation of these functional residues with other CLIC family members (e.g., alignment of C487 with C24 in CLIC1) suggests common regulatory mechanisms across the CLIC family despite divergent sequences .

What are effective approaches for validating CLIC6 expression in native tissues?

Validation of native CLIC6 expression requires a multi-faceted approach:

  • Transcriptional analysis: qRT-PCR to quantify CLIC6 mRNA levels across tissues, with lung and brain showing highest expression .

  • Protein detection: Immunoblotting or immunofluorescence using validated anti-CLIC6 antibodies .

  • Functional validation: Electrophysiological recording of IAA-94-sensitive chloride currents with characteristic voltage dependence .

  • Gene silencing: siRNA or CRISPR-Cas9 to confirm specificity of detected currents .

  • Pharmacological profile: Sensitivity to IAA-94 and response to pH and redox modulators .

In mouse lung epithelial cells, endogenous CLIC6 channels have been functionally confirmed through their electrophysiological properties and IAA-94 sensitivity .

What are key considerations for designing site-directed mutagenesis experiments with CLIC6?

When designing mutagenesis studies for CLIC6, researchers should consider:

  • Targeting conserved residues: Focus on residues conserved across CLIC family members (e.g., C487, H648) .

  • Functional domains: The N-terminal region containing C487 is critical for redox sensing, while the C-terminal domain with H648 mediates pH sensitivity .

  • Mutation strategy: Conservative substitutions (maintaining charge/polarity) versus non-conservative changes (e.g., H648A) .

  • Comprehensive functional testing: Assess both baseline channel activity and responses to modulators (pH, redox agents, IAA-94) .

  • Trafficking verification: Ensure mutations don't simply disrupt protein trafficking to the membrane .

Successful examples include the H648A and C487A mutations, which specifically disrupted pH and redox sensitivity, respectively, while affecting channel function differently .

What experimental conditions optimize the detection of CLIC6-mediated chloride transport?

For optimal detection and characterization of CLIC6 activity:

  • Solutions: Use NMDG-Cl (130-135 mM) solutions to isolate chloride currents and minimize contributions from cation channels .

  • Voltage protocol: Apply steps from -100 mV to +100 mV, with particular attention to positive potentials where CLIC6 shows enhanced activity .

  • Pharmacological tools: Include IAA-94 (10 μM) as a diagnostic blocker .

  • pH conditions: Standard recordings at pH 7.2, with pH 6.2 as a test condition to assess pH sensitivity .

  • Redox state: Control experiments with and without DTT to evaluate redox regulation .

  • Expression level optimization: Sufficient expression to detect channel activity while avoiding potential artifacts from overexpression .

Following these guidelines enables reliable detection of CLIC6 activity in both heterologous expression systems and native tissues where the channel is endogenously expressed.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.