Recombinant Rat Cholecystokinin receptor type A (Cckar)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

Rat Cholecystokinin receptor type A (CCKAR), also known as CCK-A receptor, CCK-AR, Cholecystokinin-1 receptor, or CCK1-R, is a membrane-bound receptor protein consisting of 444 amino acids . The full amino acid sequence begins with "MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENET" and represents a complex G protein-coupled receptor that interacts specifically with cholecystokinin peptides . This receptor belongs to the G protein-coupled receptor family, characterized by its seven transmembrane domains and ability to activate intracellular signaling cascades upon ligand binding.

The rat CCKAR protein has several noteworthy structural features that contribute to its functionality. It contains multiple glycosylation sites that influence its binding properties and cellular processing. When comparing native and recombinant forms, research has demonstrated that while they share the same core protein structure, differences in glycosylation patterns can be observed . Despite these structural variations, the recombinant CCKAR maintains functional properties comparable to the native receptor, including signaling cascade initiation, sensitivity to GTP analogues, and binding affinities for agonists and antagonists .

Production Methods for Recombinant CCKAR

The production of recombinant rat CCKAR has been achieved through various expression systems, each offering distinct advantages for research applications. These methods have facilitated the generation of sufficient quantities of the receptor for structural, functional, and pharmacological studies.

Bacterial Expression Systems

Escherichia coli (E. coli) represents one of the most common expression systems for recombinant CCKAR production. Studies have demonstrated the successful expression of rat pro-cholecystokinin with an amino-terminal His-Tag in E. coli, yielding approximately 0.1 micrograms of protein per milliliter of bacterial culture . While bacterial systems offer advantages in terms of scalability and cost-effectiveness, they may produce proteins with different post-translational modifications compared to mammalian cells, particularly regarding glycosylation patterns .

Insect Cell Expression Systems

Insect cell expression systems, particularly those using Sf9 and High 5 cells infected with recombinant baculovirus vectors, have proven effective for CCKAR production. This approach offers advantages for producing proteins with more complex post-translational modifications compared to bacterial systems. Research has shown that High 5 insect cells can produce approximately 4.3 micrograms of protein per milliliter of medium, which is approximately ten times the yield obtained from Sf9 or Sf21 cells . The secreted protein from insect cells undergoes tyrosine sulfation similar to its mammalian counterpart, representing an important advantage of this expression system .

Mammalian Cell Expression Systems

Chinese Hamster Ovary (CHO) cells have been successfully employed to express recombinant rat CCKAR, creating stable cell lines that express high levels of the receptor protein. These expression systems provide several advantages, including proper protein folding and post-translational modifications that more closely resemble the native receptor. Studies have shown that CHO cells stably transfected with cloned rat CCKAR can achieve a 25-fold increase in receptor density compared to native pancreatic acinar cells, while maintaining functional properties similar to the native receptor .

Purification Strategies

Purification of recombinant CCKAR typically involves multiple chromatographic steps:

  1. Affinity chromatography, often utilizing the His-tag for initial capture

  2. Ion exchange chromatography for further purification

  3. Gel filtration and/or HPLC for final polishing steps

Using a combination of ion exchange, gel filtration, and HPLC, insect cell-produced protein has been purified approximately 150-fold with a recovery of about 16% . This purified protein provides valuable material for detailed structural and functional characterization.

Binding Properties and Signaling Mechanisms

Recombinant rat CCKAR exhibits complex binding and signaling properties that have been extensively characterized through various experimental approaches. These properties are critical for understanding the receptor's physiological functions and potential as a therapeutic target.

Binding Affinity States

A distinctive feature of rat CCKAR is its ability to display two binding affinity states in the presence of adenine and guanine triphosphates. In CHO cells stably transfected with cloned rat CCKAR, 125I-CCK binding at 37°C reveals two affinity states for CCK with dissociation constant (Kd) values of 20 pM and 2.4 nM . This dual-affinity binding behavior appears to be an intrinsic property of the receptor protein rather than arising from interactions with other cellular components.

Interestingly, membranes prepared from these cells initially display only a single affinity state for CCK, but two affinity states can be restored in the presence of specific nucleotides, including GTP[γS], ATP, and ATP[γS], but not AMP-PCP . This nucleotide-dependent regulation of binding affinity represents an important mechanism for modulating receptor function in response to cellular conditions.

Role of Nucleoside Diphosphate Kinase

The effect of ATP on CCKAR binding affinity is mediated by nucleoside diphosphate kinase, an enzyme present in CHO cell membranes that transfers the terminal phosphate from ATP or ATP[γS] to GDP . This enzymatic activity plays a critical role in regulating the interconversion between the two affinity states of the receptor. This mechanism provides insight into how cellular energetic status may influence CCKAR function and signaling capacity.

Signaling Pathways

Upon activation by cholecystokinin, CCKAR initiates several intracellular signaling cascades that mediate its physiological effects. These signaling pathways include:

  1. G protein-dependent activation of phospholipase C, leading to inositol trisphosphate (IP3) production and calcium mobilization

  2. Activation of protein kinase C through diacylglycerol production

  3. Modulation of adenylyl cyclase activity, affecting cAMP levels

  4. Regulation of MAP kinase pathways involved in cell proliferation and differentiation

The functional properties of recombinant rat CCKAR expressed in CHO cells are indistinguishable from those of the native receptor found in pancreatic acinar cells, including its ability to initiate signaling cascades, sensitivity to stable GTP analogues, and binding affinities for agonists and antagonists .

Physiological Functions and Roles

CCKAR mediates numerous important physiological functions, particularly within the digestive system. Understanding these functions provides insight into the receptor's significance in health and disease.

Regulation of Food Intake

One of the most well-established functions of CCKAR is its role in regulating food intake and satiety. Research using genetically modified mouse models has demonstrated that CCKAR mediates inhibition of food intake, suggesting its importance in appetite regulation and energy balance . This function positions CCKAR as a potential target for therapeutic interventions aimed at treating obesity and related metabolic disorders.

Digestive Functions

CCKAR plays central roles in multiple digestive processes, including:

  1. Stimulation of pancreatic enzyme secretion

  2. Gallbladder contraction

  3. Regulation of gastric emptying

  4. Modulation of intestinal motility

  5. Stimulation of insulin release from pancreatic β-cells

These diverse functions highlight the receptor's importance in coordinating digestive processes and maintaining gastrointestinal homeostasis. Dysregulation of CCKAR has been implicated in various digestive disorders, further emphasizing its physiological significance .

Research Applications and Clinical Relevance

Recombinant rat CCKAR has numerous research applications and clinical implications that continue to drive scientific investigation in this field.

Diagnostic Applications

The development of sensitive and specific assays for CCKAR has enabled its measurement in various biological samples, facilitating research on its role in health and disease. The Rat CCKAR CLIA Kit, for example, allows quantitative measurement of CCKAR levels in rat serum, plasma, and cell culture supernatants with high sensitivity (18.75 pg/mL) and a detection range of 31.25-2000 pg/mL . Such tools provide valuable means for investigating CCKAR expression and regulation in various physiological and pathological conditions.

Structure-Function Studies

The availability of recombinant CCKAR has significantly advanced structure-function studies of this receptor. The fidelity of recombinant receptor expression systems, which can achieve a 25-fold increase in receptor density compared to native cells, provides an ideal substrate for examining structure-function relationships within this molecule . Such studies have yielded valuable insights into the molecular determinants of ligand binding, receptor activation, and signaling specificity.

Drug Discovery and Development

CCKAR represents an important target for drug discovery efforts aimed at treating various digestive and metabolic disorders. Recombinant rat CCKAR enables high-throughput screening of potential ligands and modulators, facilitating the identification of novel therapeutic candidates. The detailed characterization of the receptor's binding properties and signaling mechanisms provides a foundation for rational drug design approaches targeting CCKAR.

Metabolic and Digestive Disorders

Dysregulation of CCKAR has been implicated in various digestive disorders and metabolic conditions, highlighting its importance as a potential therapeutic target . Research on recombinant rat CCKAR contributes to understanding the molecular basis of these disorders and developing targeted interventions. Conditions potentially associated with CCKAR dysfunction include:

  1. Obesity and metabolic syndrome

  2. Functional gastrointestinal disorders

  3. Pancreatic insufficiency

  4. Gallbladder disease

  5. Certain forms of diabetes mellitus

Comparative Analysis with Other Species

Comparing rat CCKAR with its counterparts in other species provides valuable evolutionary and functional insights. For instance, recombinant full-length rabbit CCKAR (O97772), spanning amino acids 1-427, shares significant homology with rat CCKAR but exhibits some species-specific differences . These comparative analyses help identify conserved regions critical for receptor function as well as variable regions that may underlie species-specific responses to cholecystokinin.

Future Research Directions

Future research on recombinant rat CCKAR will likely focus on several promising directions:

  1. Detailed structural studies using advanced techniques such as cryo-electron microscopy to elucidate the three-dimensional structure of the receptor

  2. Investigation of CCKAR dimerization and interactions with other receptors and signaling molecules

  3. Development of subtype-selective ligands for more precise targeting of CCKAR in specific tissues

  4. Further characterization of CCKAR's role in metabolic regulation and potential applications in treating obesity and diabetes

  5. Exploration of CCKAR polymorphisms and their association with disease susceptibility

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cckar; Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQI LLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAAT WCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVM VVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQL SSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAE KHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEE DGRTIRALLSRYSYSHMSTSAPPP
Uniprot No.

Target Background

Function
The cholecystokinin receptor type A (CCK-AR) is a receptor for cholecystokinin (CCK). It mediates pancreatic growth and enzyme secretion, gallbladder and stomach smooth muscle contraction. CCK-AR exhibits 1000-fold higher affinity for CCK than gastrin. Furthermore, it modulates feeding behavior and dopamine-induced responses in the central and peripheral nervous systems, mediating its actions through G protein-coupled activation of a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Colocalization of CCKAR and melanin-concentrating hormone (MCH) receptors in neurons of the lateral hypothalamus (LH) and zona incerta (ZI) was demonstrated; however, MCHR1 mRNA is more broadly expressed throughout the brain. PMID: 24978951
  2. Apolipoprotein AIV (Apo AIV) in the nucleus of the solitary tract (NTS) and/or peripheral CCK require vagal CCK1R/CCKAR signaling to induce satiation; high-fat diets reduce the satiating effects of these signals. PMID: 24564397
  3. Factors secondary to obesity and/or diabetes, rather than impaired CCK-1 receptor signaling, may contribute to altered CART expression. PMID: 23545074
  4. CCK-A receptors are located on the cell bodies of cholinergic interneurons in the corpus striatum. PMID: 22981453
  5. Activation of duodenal protein kinase C-delta (PKC-δ) stimulates CCK release and activates the CCK-A receptor signaling pathway, lowering glucose production in normal rats. PMID: 21984583
  6. The Homo-Phe derivative 2 (VL-0797) increased the affinity for rat and human CCK(1)-R by 12-fold and 15-fold, respectively, compared to the reference compound 12 (VL-0395). PMID: 21728335
  7. L-364,718 potentiates electroacupuncture analgesia through the CCK-A receptor of pain-excited and pain-inhibited neurons in the nucleus parafascicularis. PMID: 20953702
  8. CCK1 and CCK2 receptors are expressed on pancreatic stellate cells and induce collagen production. PMID: 20843811
  9. This study demonstrates that the CCK-1 receptor plays a crucial role in both meal-induced and fasting insulin sensitization. PMID: 20624386
  10. This study examined the contribution of genetics, sex, and early maternal environment to anxiety-like behaviors and locomotion in CCK1 knockout rats, suggesting that the mutation may predispose (rather than induce) the animals to an anxious phenotype. PMID: 20347877
  11. Increased oil intake in CCK-1 receptor-deficient rats is driven by peripheral satiation deficits and altered orosensory sensitivity. PMID: 19887078
  12. Gastric leptin may exert acute sympathoinhibitory and cardiovascular effects via vagal transmission and CCK(1) receptor activation, playing a distinct role from adipose leptin in short-term cardiovascular regulation. PMID: 19940076
  13. Activation of high-affinity CCK(A) receptors elicits Ca(2+) oscillations, while low-affinity CCK(A) receptor stimulation evokes a sustained Ca(2+) plateau; these are mediated through L-type Ca(2+) channels and involve G(q) proteins. PMID: 12016125
  14. CCKB, but not CCKA receptors, are involved in anxiety, as demonstrated by microinjection of cholecystokinin agonists. PMID: 12373548
  15. Endogenous CCK acts partly via a paracrine or neurocrine mechanism at CCKARs peripheral to the blood-brain barrier to inhibit gastric emptying. PMID: 12388446
  16. Endogenous CCK acts partly at CCKARs peripheral to the blood-brain barrier to inhibit food intake. PMID: 12414437
  17. None of the three known phases of the rat febrile response to lipopolysaccharides require the CCK-A receptor. PMID: 12562931
  18. Cholecystokinin stimulates tyrosine phosphorylation of three sites in focal adhesion kinase and proline-rich kinase 2, differing in the involvement of the cholecystokinin receptor A and by protein kinase C and [Ca2+]. PMID: 12651850
  19. CCK-AR and CCK-BR genes are present in pulmonary vascular endothelial cells, macrophages, bronchial epithelial cells, and alveolar epithelial cells, mediating the regulatory actions of CCK-8 on these cells. PMID: 12800239
  20. Peripheral and central responses to enterostatin are mediated through or dependent on peripheral and central CCK-A receptors. PMID: 12855414
  21. CCK-A receptors play a significant role in regulating central dopamine transmission, as shown in studies of the CCK-A receptor-deficient Otsuka Long Evans Tokushima Fatty (OTLEF) rat strain. PMID: 12932815
  22. Spatial memory was impaired in OLETF rats with a genetic abnormality in the CCK-A receptor. PMID: 14607104
  23. CCK-A and CCK-B receptor mRNAs were identified in the rat retina and shown to be functional, stimulating tyrosine phosphorylation pathways. PMID: 14698681
  24. Type A CCK receptors are involved in mediating the inhibitory effect of large doses of ethanol on gastric emptying. PMID: 14700745
  25. Acute pancreatitis induced by bile-pancreatic duct ligation is associated with a temporal increase in pancreatic cholecystokinin-A receptor protein expression, p38 mitogen-activated protein kinase activation, and nuclear factor-kappaB activation. PMID: 14988658
  26. Apo A-IV released from the intestinal mucosa during lipid absorption stimulates endogenous CCK release, activating CCK(1) receptors on vagal afferent nerve terminals, initiating feedback inhibition of gastric motility. PMID: 15117731
  27. Cholecystokinin A receptors have differential roles in energy balance in rats and mice. PMID: 15123537
  28. OLETF rats showed significant hysteresis. PMID: 15178543
  29. Taste preference differences were observed in Otsuka Long-Evans Tokushima fatty (OLETF) rats with a deficiency in this receptor. PMID: 15358606
  30. Compared to controls, OLETF rats exhibit augmented sweet sensitivity, which progresses during prediabetes. PMID: 16081877
  31. Lack of CCK-1 receptors, or other OLETF-related abnormalities, resulted in satiation deficits, leading to increased meal size, hyperphagia, and increased weight gain as early as 2-4 postnatal days. PMID: 16099824
  32. Cholecystokinin-8 activates brainstem and myenteric neurons through the CCK1 receptor. PMID: 16112401
  33. CCK1 receptors play a role in stress and pain responses in rats. PMID: 16289472
  34. Under basal conditions, a portion of glandular protein synthesis, and the entire increase in synthesis in response to pentagastrin, engaged both types of CCK receptors. PMID: 16556659
  35. OLETF rats do not exhibit deficits in controlling gastric emptying rates; however, they show decreased behavioral and vagal responsiveness to gastric distension, potentially contributing to increased meal size. PMID: 16728725
  36. Review: Hyperphagia and obesity in OLETF rats lacking CCK-1 receptors. PMID: 16815799
  37. Effects of cholecystokinin-58 on type 1 cholecystokinin receptor function and regulation. PMID: 18776046
  38. Cholecystokinin CCK1 and serotonin 5-HT3 receptors mediate the excitatory effects of cholecystokinin and 5-HT, respectively, on pancreatic vagal afferent discharge. PMID: 19026634
  39. Fischer 344 rats lacking the cholecystokinin-1 receptor gene exhibit normal feeding and body weight. PMID: 19111529
  40. In addition to previously described deficits in peripheral satiety signals and augmented orexigenic regulation, the anorectic effect of CART peptide may also be diminished in CCK-1 deficient rats. PMID: 19533109
  41. Endogenous CCK-1 receptor signaling in infants is a potential pathway through which maternal-pup interactions regulate the development and functional organization of emotional circuits that control anxiety-like behavior in the offspring. PMID: 20001102
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Pancreas and brain. Also expressed in the gastrointestinal system and vagus nerve.

Q&A

Does recombinant Cckar maintain the same functional properties as native receptors?

Despite structural differences in glycosylation, recombinant Cckar expressed in CHO cells is functionally indistinguishable from native receptors in pancreatic acinar cells . This functional equivalence extends to signaling cascade initiation, sensitivity to stable GTP analogues, and binding affinities for both agonists and antagonists . This preserved functionality makes recombinant systems valuable for structure-function studies, offering a 25-fold increase in receptor density compared to native pancreatic acinar cells .

What expression systems are most effective for producing recombinant rat Cckar?

Chinese hamster ovary (CHO) cell lines have been established as particularly effective for stable expression of recombinant rat Cckar . These systems allow for significantly higher receptor expression levels (up to 25-fold increase) compared to native tissues while maintaining proper receptor folding and function . CHO-K1 cells expressing aequorin have also been used successfully as an assay system to study ligand-receptor interactions and measure concentration-dependent responses in transfected cells expressing Cckar .

Which specific amino acid residues are critical for Cckar binding and signaling functions?

Extensive mutagenesis studies of CCK receptors have identified numerous critical residues across different receptor domains. Key findings from structure-function analyses include:

DomainCritical ResiduesFunctional ImpactSpecies
N-terminusC18, C29Maintain normal binding affinityRat
TM2C94L>10,000-fold reduction in bindingHuman
TM3C114S1000-fold reduction in potencyRat
ECL2R197 (various mutations)Dramatic effects on potency and efficacyRat/Human
TM7L356A805-fold (high affinity) binding reductionHuman

The arginine residue at position 197 in ECL2 appears particularly crucial, as mutations (R197A, R197M, R197K, R197D, R197E) significantly impact receptor function, with some mutations causing complete loss of activity . These studies demonstrate the complex structural requirements for proper Cckar function.

How do post-translational modifications affect recombinant Cckar properties?

Glycosylation patterns significantly impact the structural properties of Cckar without altering its functional characteristics . The native rat pancreatic acinar cell receptor shows different lectin-binding properties compared to recombinant receptors, specifically in binding to Ulex europeus agglutinin I, indicating differences in fucosylation that occurs late in glycoprotein biosynthesis . When investigating ligand binding, it's important to consider that while these glycosylation differences don't affect binding affinities for agonists and antagonists, they may impact other aspects such as receptor trafficking or interaction with other cellular components .

What is known about the interaction between Cckar and other signaling systems, particularly leptin?

Research demonstrates significant interplay between cholecystokinin and leptin signaling pathways. In rat models, leptin pre-treatment enhances calcium responses to CCK, suggesting that leptin can positively modulate CCK signaling . Both leptin and CCK receptors appear to contribute to short-term satiety mechanisms, with potential synergistic effects . At the cellular level, this interaction has been studied using immunohistochemistry to visualize nuclear pSTAT3 immunoreactivity and c-Fos immunoreactivity in the ventromedial hypothalamus following leptin administration . This research highlights the complex integration of different satiety signals, with Cckar playing a crucial role in these regulatory networks.

What are the most effective methods for confirming successful expression of functional recombinant rat Cckar?

A multi-faceted approach is recommended to confirm successful expression:

  • Biochemical characterization: SDS-PAGE analysis followed by immunoblotting can verify expression, but expect different migration patterns between recombinant and native receptors due to glycosylation differences .

  • Deglycosylation studies: Treatment with endoglycosidase F allows comparison of core protein sizes between recombinant and native receptors .

  • Functional assays: Measure calcium mobilization using aequorin-based luminescence assays in transfected cells to confirm receptor functionality . Concentration-dependent response curves should be generated using known Cckar ligands.

  • Binding assays: Affinity labeling and competitive binding assays with agonists and antagonists can verify proper ligand recognition properties .

  • GTP sensitivity tests: Assessing receptor sensitivity to stable GTP analogues provides further confirmation of proper G-protein coupling .

How can researchers effectively differentiate between high and low affinity binding sites in Cckar studies?

When studying Cckar binding characteristics, it's crucial to account for the receptor's known ability to exist in both high and low affinity states. Multiple approaches can help differentiate these states:

  • Use concentration curves spanning several orders of magnitude to fully capture binding behavior across different affinity states .

  • Analyze binding data using two-site binding models that can mathematically distinguish between high and low affinity populations .

  • Utilize GTP analogues to shift receptors toward low affinity states, allowing better characterization of the different binding populations .

  • When reporting mutation effects on binding, separately analyze impacts on high and low affinity states, as some mutations differentially affect these populations . For example, the L356A mutation shows dramatic effects (805-fold reduction) on high affinity binding while having much smaller effects (8-fold) on low affinity binding .

What are the optimal peptide ligands for studying recombinant rat Cckar activation?

For studying rat Cckar activation, both sulfated and non-sulfated cholecystokinin peptides can be effective, though with substantially different potencies. Studies using CHO-K1 cells expressing aequorin have demonstrated that:

  • Sulfated peptides like ArSK/CCK1 and ArSK/CCK2 are highly potent, with EC50 values of 0.25 nM and 0.12 nM respectively .

  • Non-sulfated peptides (e.g., ArSK/CCK2(ns)) can also activate the receptor but with dramatically reduced potency (EC50 of 48 μM) .

  • Both sulfated and non-sulfated forms can be detected in tissue extracts, making both biologically relevant for research .

When designing experiments, researchers should consider that the ~400,000-fold difference in potency between sulfated and non-sulfated forms will significantly impact experimental design, including concentration ranges and detection sensitivity requirements .

How should researchers interpret differences between recombinant and native Cckar experimental results?

When comparing data between recombinant and native Cckar systems, consider these key factors:

  • Expression levels: Recombinant systems typically show 25-fold higher receptor density than native tissues, which may affect apparent potency in functional assays .

  • Glycosylation differences: While core functions remain intact, differences in glycosylation patterns between native and recombinant receptors may impact certain measurements, particularly in studies of receptor trafficking or cell-surface dynamics .

  • Cellular context: Native receptors exist in a complex cellular environment with endogenous regulatory proteins that may be absent in recombinant systems .

  • Species variations: When comparing rat recombinant Cckar with human or other species data, note that species-specific differences exist in key residues that may affect pharmacological properties .

Despite these considerations, the functional equivalence between recombinant and native Cckar in terms of signaling, GTP sensitivity, and ligand binding makes recombinant systems highly reliable models for most research applications .

What approaches can resolve contradictory findings in Cckar mutation studies?

When faced with seemingly contradictory results in mutation studies, consider these methodological approaches:

  • Examine experimental systems: Different expression systems or cell backgrounds may introduce variables that affect results . CHO cells are widely used but may not recapitulate all aspects of native cellular environments.

  • Consider mutation context: The effect of a specific mutation may depend on the background sequence or other mutations present . The extensive mutation data available for Cckar (see table in section 2.1) shows that the same mutation can have dramatically different effects depending on context.

  • Assess measurement sensitivity: Some functional effects may only be apparent with highly sensitive assays or at specific concentration ranges .

  • Differentiate binding from functional effects: A mutation might affect binding affinity without changing efficacy, or vice versa . The comprehensive mutation data compiled in the literature shows many examples where binding and efficacy effects diverge.

  • Consider species differences: When comparing results between studies, note whether rat or human receptor constructs were used, as key differences exist .

How conserved is Cckar structure and function across species?

Cholecystokinin receptors show remarkable evolutionary conservation in their core functions while exhibiting species-specific variations in structure. The sulfakinin (SK)/cholecystokinin (CCK)-type neuropeptide signaling system regulates feeding and digestion across diverse phyla, from protostomes (e.g., insects) to chordates . Comparative studies reveal:

  • Core transmembrane domains and key binding residues show high conservation across mammals, particularly in regions critical for ligand binding .

  • Species-specific variations exist, particularly in extracellular domains and post-translational modifications .

  • Functional studies demonstrate that despite structural differences, the fundamental signaling mechanisms are preserved across species .

  • Ancient evolutionary origins are evident from the presence of similar receptor systems in invertebrates, suggesting that this signaling system predates the divergence of major animal lineages .

Understanding these evolutionary relationships provides valuable context for interpreting differences observed between rat Cckar and its homologs in other species .

What are the most promising approaches for studying Cckar-mediated intracellular signaling dynamics?

Advanced research into Cckar signaling dynamics should consider these cutting-edge approaches:

  • Real-time signaling visualization: Utilizing fluorescent biosensors to monitor calcium mobilization, cAMP production, and other second messengers in living cells expressing recombinant Cckar .

  • Investigation of receptor heterodimers: Exploring potential interactions between Cckar and other receptors, particularly given the observed interplay with leptin signaling systems .

  • Single-cell analysis techniques: Applying technologies that can measure signaling responses in individual cells to capture the heterogeneity in receptor expression and function .

  • Systems biology approaches: Integrating data from multiple signaling pathways to understand how Cckar contributes to complex physiological responses, particularly in feeding regulation and satiety .

  • Development of biased ligands: Creating peptides that selectively activate specific Cckar signaling pathways, potentially leading to more targeted therapeutic applications .

These approaches would build on the extensive foundation of structure-function knowledge while pushing toward a more comprehensive understanding of Cckar's role in complex physiological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.