Recombinant Rat Choline transporter-like protein 3 (Slc44a3)

Shipped with Ice Packs
In Stock

Description

Table 1: Protein Characteristics

PropertyDetail
Molecular Weight67.7 kDa (67,679 Da)
Expression SystemE. coli
Expression RegionFull-length protein (amino acids 1-604)
Purity≥85% (SDS-PAGE)
TagN-terminal 10xHis tag

The protein sequence includes conserved domains critical for choline transport, such as transmembrane helices and residues involved in proton-coupled exchange (e.g., MGYSVVAGAAGRLLFGYDSFGNVCGKRNSPVEGAPLSGQDMTLKKHVFFMN...) .

Production and Purification

Recombinant Slc44a3 is produced via in vitro expression in E. coli systems. Protocols emphasize:

  • Storage: Lyophilized or liquid forms at -20°C or -80°C for long-term stability .

  • Handling: Avoid repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week .

  • Sterility: Available with low endotoxin and sterile filtration upon request .

Functional and Mechanistic Insights

While CTL1 (SLC44A1) facilitates Na+-independent, intermediate-affinity choline transport for phospholipid synthesis and apoptosis regulation , Slc44a3’s role remains unclear. Key hypotheses based on CTL family homology include:

  • Choline Transport: Potential involvement in pH-dependent, proton-coupled choline uptake .

  • Cellular Roles: May support membrane phospholipid synthesis or non-neuronal acetylcholine production .

Notably, no direct functional studies on recombinant Slc44a3 have been published, highlighting a critical research gap.

Table 2: Potential Applications

ApplicationUse Case
Antibody Blocking StudiesValidate antibodies (e.g., PA5-61517) via pre-adsorption controls
Structural BiologyInvestigate transmembrane topology via crystallography or cryo-EM
Pharmacological ScreeningIdentify inhibitors/modulators for choline transport pathways

Challenges and Future Directions

  1. Functional Characterization: No kinetic data (e.g., Km or Vmax) or substrate specificity profiles exist for Slc44a3.

  2. Physiological Relevance: Its role in choline metabolism, cancer, or neurological disorders remains speculative.

  3. Therapeutic Potential: Unlike CTL1 inhibitors (e.g., Amb4269951), no Slc44a3-targeted compounds have been reported .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
The delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributors.
As a standard practice, all our proteins are shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes a final glycerol concentration of 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us during your order. We will prioritize the development of your requested tag type if feasible.
Synonyms
Slc44a3; Ctl3; Choline transporter-like protein 3; Solute carrier family 44 member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc44a3
Target Protein Sequence
MGYSVVAGAAGRLLFGYDSFGNVCGKRNSPVEGAPLSGQDMTLKKHVFFMNACNLEVKDR GRGPMALCVSSCPEKQLDTLEEVQLFANINGSFLCVYSLNSFNYTQSPSADRLCPRLPVP PSKPFPLFNRCIPQTPECYSLFASVLLNDADALHRILSGIMAGRDTILGLCAFVFALSLA MLFTFRFISTLLVHIIISLVILGLLFVCGVFWWLYYDYTNDLSTELDTEKENMKCMLAFA VITTVVTVVLLALIFTLRKRVKLTVELLRVTNKAISRCPFLLLQPLWTFAILVFFWVLWV AVLLSLGTAGTAQVMEGGQVEYKPLSGIRYLWWYHLIGLIWTSEFILTCQRMTVAGAMVT CYFNRNQNDPPARPILSSLSTLFCYHQGTAVKGSLLLTVTRIPRVIFMYIYSTVKERHSA WPRGEFRCSYCGLWCLTNYPYHLNQDAYAAAAINGTDFCTSAKDAHTIISKNSSHLTSVN CFGNFIIFLGKVLVVCFSVFGGLMAFNYNRALQVWAIPLLLVAFFAYLAAHSFLSVFETV LDTLFLCFAVDLETNDGSSEKPYFMDPGFLSFVKRTDHFNNARSQGHKNSLPNEEGTELR PIVR
Uniprot No.

Target Background

Database Links
Protein Families
CTL (choline transporter-like) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in colon, kidney and ileum.

Q&A

What is Choline Transporter-Like Protein 3 (Slc44a3) and how is it classified among choline transporters?

Choline Transporter-Like Protein 3 (Slc44a3/CTL3) belongs to the SLC44 family, which consists of five members (CTL1-5/SLC44A1-5) . Choline transporters are generally categorized into three major families: (I) high-affinity choline transporter 1 (CHT1/SLC5A7), (II) choline transporter-like proteins (CTL1-5/SLC44A1-5), and (III) polyspecific organic cation transporters (OCT1-2/SLC22A1-2) with lower affinity for choline . Slc44a3 is part of the intermediate-affinity transport system, distinguishing it from the high-affinity CHT1 transporter that is primarily expressed in cholinergic neurons and the lower-affinity OCT transporters that have broader substrate specificity.

Unlike CHT1, which is strictly sodium-dependent, CTL family transporters generally demonstrate sodium-independent transport mechanisms, suggesting different physiological roles in choline homeostasis . The gene encoding rat Slc44a3 has been mapped and characterized in the context of the broader choline transporter family, providing a foundation for comparative studies across species.

How do CTL family transporters differ functionally from other choline transport systems?

CTL family transporters, including Slc44a3, represent a distinct functional class within the choline transport systems. While CHT1 (SLC5A7) operates as a high-affinity, strictly sodium-dependent transporter primarily serving cholinergic neurons for acetylcholine synthesis, the CTL family generally functions through sodium-independent mechanisms with intermediate affinity for choline .

In functional studies, CHT1-mediated transport demonstrates a strong dependence on extracellular sodium, with dramatically reduced transport activity when sodium is absent . In contrast, the CTL family transporters, including CTL3, can maintain significant transport activity in sodium-free conditions. This key functional difference suggests that CTL3 may play important roles in choline transport in contexts where sodium gradients are not maintained or are less relevant to cellular function.

The substrate specificity also differs between transporter families. While the high-affinity CHT1 is highly selective for choline, the CTL family may transport additional substrates beyond choline. For example, the rabbit homolog of the putative rat choline transporter CHOT1 has been shown to mediate creatine transport, demonstrating the potential functional diversity within this transporter class .

What methods should be used to determine the tissue distribution of Slc44a3?

To determine the tissue distribution of Slc44a3, researchers should employ multiple complementary techniques to ensure comprehensive and accurate characterization. Real-time PCR using specifically designed TaqMan probes represents a sensitive and quantitative approach to detect Slc44a3 mRNA expression across different tissues.

For Slc44a3 specifically, researchers can use primers spanning exons 5-6 of the gene, with an assay location at position 625 and amplicon length of 64 base pairs, similar to the approach used for other CTL family members . Primer design should ensure specificity for Slc44a3 without cross-reactivity with other family members. Expression levels should be calculated relative to a housekeeping gene such as GAPDH using the comparative cycle time method (2^-(Ct target–Ct GAPDH)×100%) .

Northern blot analysis can complement qPCR data by revealing the size and integrity of Slc44a3 transcripts. Previous studies of related transporters identified major transcripts of specific sizes in different tissues. For example, CHT1 showed a major transcript of 4.8 kb in brain, heart, skeletal muscle and kidney . Similar analysis for Slc44a3 would establish its expression pattern.

In situ hybridization provides spatial information about Slc44a3 expression within tissues, revealing cell-specific expression patterns that cannot be determined by PCR or Northern blot. This is particularly important for heterogeneous tissues like the brain, where transporter expression may be restricted to specific regions or cell types .

What are the optimal expression systems for producing recombinant rat Slc44a3?

The selection of an appropriate expression system is critical for successful functional characterization of recombinant rat Slc44a3. Based on successful approaches with related transporters, several expression systems can be considered:

Human embryonic kidney (HEK293) cells represent an excellent mammalian expression system for Slc44a3 studies. These cells have been successfully used for stable expression of related transporters like CHT, allowing for robust functional characterization . HEK293 cells offer advantages including high transfection efficiency, proper post-translational modifications, and relatively low background of endogenous choline transporters.

For recombinant Slc44a3 expression, researchers should consider using codon-optimized constructs to enhance expression levels. This approach has proven effective with related transporters, where codon optimization significantly increased protein expression without altering functional properties . The recombinant construct should include a verification tag (such as GFP or a small epitope tag) to facilitate detection and confirmation of expression, while ensuring the tag does not interfere with transporter function.

When establishing stable cell lines, multiple clones should be isolated and characterized to identify those with optimal expression levels. Quantitative PCR should be performed to verify overexpression of the Slc44a3 transcript compared to parental cells, while also confirming that the expression of other choline transporters and related genes remains unchanged .

Neuroblastoma cell lines such as SH-SY5Y can also be considered as an alternative expression system, especially for studies investigating neuronal-specific aspects of Slc44a3 function. These cells provide a more neuron-like environment which may be relevant for certain functional studies .

How can researchers validate successful expression of recombinant rat Slc44a3?

Validation of successful Slc44a3 expression requires a multi-faceted approach combining molecular, biochemical, and functional methods:

Quantitative PCR should be performed using primers specific to the recombinant Slc44a3 construct, distinguishing it from any endogenous transporter expression. Researchers should compare expression levels between the recombinant cell line and the parental cell line, expecting significantly higher expression in the recombinant cells. For example, in studies with related transporters, qPCR revealed significant overexpression of the codon-optimized transporter transcript but not endogenous transcript in recombinant cell lines .

Researchers should also verify that expression of other related transporters and proteins involved in choline metabolism remains unchanged in the recombinant cells. For choline transporters, this includes checking expression of other family members (SLC5A7/CHT1, SLC44A1-5/CTL1-5, SLC22A1-2/OCT1-2) .

Immunocytochemistry or fluorescence microscopy (if using a fluorescent tag like GFP) helps determine the subcellular localization of Slc44a3. This is crucial for confirming proper trafficking of the transporter to the plasma membrane. Different choline transporters demonstrate distinct subcellular localizations; for example, CTL1 localizes to the plasma membrane while CTL2 is predominantly found in mitochondria .

What are the most effective methods for measuring Slc44a3-mediated transport activity?

For functional characterization of Slc44a3-mediated transport, researchers can employ several complementary approaches:

The radiometric assay using [³H]choline uptake represents a traditional and reliable method for measuring transporter function. This approach involves incubating cells expressing Slc44a3 with radiolabeled choline and measuring accumulated radioactivity. To enhance throughput, researchers can utilize a proximity-based scintillation approach, where cells are grown on plates with scintillant embedded in the base, allowing direct detection of transported [³H]choline without cell lysis .

When implementing this assay, researchers should optimize key parameters including cell seeding density, assay timing post-seeding, plate coating, buffer composition, reading time, and choline concentration. Appropriate controls are essential, including measurements in the presence of transport inhibitors to determine non-specific uptake .

Mass spectrometry-based methods offer an alternative, non-radioactive approach for measuring choline transport. This technique involves measuring the uptake of stably labeled choline (such as deuterated choline chloride-d9) coupled with mass spectrometric quantification. This method has been successfully employed with other choline transporters and offers several advantages, including the ability to generate complete saturation curves to determine Km values accurately .

MethodAdvantagesLimitationsKey Parameters
Radiometric ([³H]choline)High sensitivity, established methodologyRadiation safety concerns, limited throughputCholine concentration, incubation time, sodium dependence, pH dependence
Mass spectrometry (D9-choline)No radiation, complete saturation curves possibleRequires specialized equipment, higher costD9-choline concentration, sample preparation, instrument calibration
ElectrophysiologyReal-time measurements, mechanistic insightsTechnical complexity, specialized equipmentBuffer composition, electrode configuration, signal amplification

How does sodium dependence affect Slc44a3 transport function?

The sodium dependence profile of transporters provides critical mechanistic insights into their function and physiological role. Unlike the high-affinity choline transporter CHT1 (SLC5A7), which demonstrates strict sodium dependence, the CTL family transporters (including Slc44a3) generally exhibit sodium-independent transport mechanisms .

To experimentally characterize the sodium dependence of Slc44a3, researchers should perform choline uptake measurements in both sodium-containing and sodium-free buffers. In sodium-free conditions, sodium chloride should be replaced with an equimolar concentration of an alternative salt, typically choline chloride, lithium chloride, or N-methyl-D-glucamine chloride, while maintaining osmolarity and ionic strength.

For comparison, CHT1-expressing cells show dramatically reduced [³H]choline uptake in sodium-free conditions, with activity dropping to less than 10% of the sodium-containing condition . In contrast, CTL family transporters maintain significant transport activity in sodium-free conditions, although the exact level of sodium independence may vary among family members.

The sodium independence of Slc44a3 suggests that it may play important roles in tissues or cellular compartments where sodium gradients are not maintained or in conditions where the sodium gradient is disrupted. This functional characteristic may also influence the pharmacological profile and regulatory mechanisms of Slc44a3 compared to sodium-dependent transporters.

What is the significance of pH on Slc44a3 transport activity?

The pH dependence of transporter function provides insights into the mechanisms of substrate binding and translocation, as well as the physiological contexts in which the transporter may be most active. For choline transporters, pH sensitivity varies across different family members and may indicate distinct functional roles.

To characterize the pH dependence of Slc44a3, researchers should measure transport activity across a range of pH values, typically from pH 5.5 to 8.5, while maintaining consistent buffer composition except for the pH-adjusting component. Previous studies with related transporters have shown that decreasing pH can enhance the response to certain compounds, such as staurosporine (STS), which potentiates choline transport .

The pH sensitivity profile provides clues about the protonation states of key residues involved in transport and may help identify critical functional domains in the Slc44a3 protein. Additionally, pH dependence information may guide optimization of experimental conditions for drug screening or functional assays.

From a physiological perspective, pH sensitivity may indicate the tissues or cellular compartments where Slc44a3 is most active. For example, transporters that function optimally at lower pH may be particularly important in acidified environments such as certain endosomal compartments or tissues with naturally acidic extracellular fluid.

How can Slc44a3 be studied in the context of neurological function?

Studying Slc44a3 in neurological contexts requires specialized approaches that account for the complex environment of the nervous system. Researchers should consider the following methodological approaches:

In situ hybridization and immunohistochemistry can reveal the regional and cellular distribution of Slc44a3 in the brain. Previous studies of related transporters have shown distinct expression patterns in brain regions such as the cerebellum, hippocampus, and along the neuraxis during development . For Slc44a3, similar mapping would establish its neuroanatomical profile and suggest potential functional roles.

Primary neuronal cultures provide a more physiologically relevant system for studying Slc44a3 function compared to heterologous expression systems. Researchers can isolate primary neurons from specific brain regions of rat embryos or neonates, maintain them in culture, and study endogenous or overexpressed Slc44a3. This approach preserves neuronal morphology and many aspects of in vivo physiology.

For studying the role of Slc44a3 in synaptic function, researchers can employ electrophysiological techniques such as patch-clamp recording in brain slices or cultured neurons with manipulated Slc44a3 expression. These techniques can reveal whether Slc44a3 influences neuronal excitability, synaptic transmission, or plasticity.

To investigate the contribution of Slc44a3 to neurological disorders, researchers can analyze its expression and function in animal models of conditions such as Alzheimer's disease, Parkinson's disease, or epilepsy. Changes in Slc44a3 expression or function in these models may suggest potential roles in pathogenesis or compensation.

What methodological approaches are recommended for studying the role of Slc44a3 in cancer models?

Choline transporters have emerged as important players in cancer biology due to the critical role of choline in phospholipid synthesis and cell membrane formation during rapid cell proliferation. For studying Slc44a3 in cancer contexts, researchers should consider:

Expression analysis across cancer cell lines and tumor tissues using qPCR and Western blotting can establish whether Slc44a3 is differentially expressed in malignant versus normal tissues. The CTL family of transporters has shown altered expression in various cancers; for example, CTL1 and CTL2 are expressed in prostate cancer cell lines . Similar analysis for Slc44a3 would establish its profile in oncogenic contexts.

Functional consequences of Slc44a3 expression in cancer cells can be assessed by manipulating its expression levels through overexpression or knockdown/knockout approaches. Following manipulation, researchers should measure parameters such as cell proliferation, migration, invasion, and resistance to apoptosis to determine whether Slc44a3 contributes to cancer cell phenotypes.

To connect Slc44a3 function with cancer cell viability, researchers can assess correlations between choline uptake and cell viability in drug-treated cells. Studies with prostate cancer cells have shown significant correlations between the effects of anticancer drugs on cell viability and [³H]choline uptake, suggesting a functional link between choline transport and cancer cell survival .

The mechanism by which Slc44a3 may influence cancer cell survival can be investigated by measuring apoptotic markers such as caspase-3/7 activity following modulation of Slc44a3 expression or function. In prostate cancer cells, anticancer drugs that inhibited choline uptake also increased caspase-3/7 activity, suggesting a potential mechanistic connection .

How can researchers distinguish between the functions of different choline transporters in experimental settings?

Distinguishing between the functions of various choline transporters in experimental settings requires a strategic combination of approaches:

Pharmacological profiling using inhibitors with different selectivity profiles can help distinguish between transporter subtypes. For example, hemicholinium-3 (HC-3) has high affinity for CHT1 but lower affinity for CTL family transporters, allowing researchers to pharmacologically isolate CHT1-mediated transport . By applying specific inhibitors at carefully selected concentrations, researchers can parse out the contribution of individual transporters to total choline uptake.

Sodium dependence provides another distinguishing characteristic, as CHT1-mediated transport is strictly sodium-dependent, while CTL family transporters (including Slc44a3) generally function through sodium-independent mechanisms . By measuring choline uptake in both sodium-containing and sodium-free conditions, researchers can differentiate between these transport systems.

Kinetic analysis of transport activity across different concentrations of choline can reveal distinct transporter populations based on their affinity parameters. CHT1 demonstrates high-affinity transport (Km in the low micromolar range), while CTL family transporters typically show intermediate affinity, and OCT transporters exhibit low affinity . A careful analysis of saturation curves can identify the contribution of different transporters to total choline uptake.

Genetic manipulation through selective knockdown or knockout of specific transporters, coupled with rescue experiments using wild-type or mutant constructs, provides the most definitive approach to isolate the function of Slc44a3 from other choline transporters. This approach can be implemented in cell lines or animal models using techniques such as siRNA, CRISPR-Cas9, or traditional knockout methods.

What are common technical challenges when working with recombinant Slc44a3 and how can they be addressed?

Working with membrane transporters like Slc44a3 presents several technical challenges that researchers should anticipate and address:

Low expression levels of functional protein can limit experimental outcomes. To overcome this, researchers should optimize expression systems using strong promoters and codon-optimized sequences. Studies with related transporters have successfully used codon-optimized constructs that significantly increased expression levels . Additionally, screening multiple clones after stable transfection can identify those with optimal expression.

Improper membrane trafficking may result in retention of the transporter in intracellular compartments rather than localization to the plasma membrane. This can be addressed by using epitope tags or fluorescent fusion proteins to track localization, coupled with confocal microscopy to verify membrane expression. If trafficking issues persist, researchers can explore the use of lower incubation temperatures (e.g., 30°C instead of 37°C) during expression, which sometimes improves membrane protein folding and trafficking.

Background transport activity from endogenous transporters can confound the interpretation of results. Researchers should carefully characterize parental cell lines to quantify background transport and select expression systems with minimal endogenous choline transporter expression. All experiments should include proper controls, including parental cells and transport in the presence of inhibitors, to distinguish specific from non-specific uptake .

Assay variability can be minimized through careful optimization of experimental conditions. For radiometric assays, researchers should standardize parameters such as cell density, incubation time, and buffer composition. Previous studies found that choline starvation, use of a sodium gradient, and manipulation of pH can improve assay windows and reduce variability .

How can researchers optimize choline transport assays for high-throughput screening applications?

For high-throughput screening applications targeting Slc44a3, researchers should consider several optimization strategies:

Fluorescence-based approaches using fluorescent choline analogs can be developed for truly high-throughput applications compatible with standard plate readers. While such assays would require validation against established methods, they could significantly increase throughput and accessibility.

For any high-throughput assay, careful optimization of key parameters is essential. These include cell seeding density, assay timing, plate format and coating, buffer composition, reading time, and substrate concentration. Additionally, researchers should establish robust statistical parameters for hit identification, including Z'-factor calculations to ensure assay quality and reproducibility.

ParameterOptimization StrategyImpact on Assay Performance
Cell densityTitrate to determine optimal densityAffects signal window and consistency
Incubation timeBalance between signal development and linear uptake rangeLonger times may improve signal but increase variability
Substrate concentrationUse concentration near Km for inhibitor screeningEnsures sensitivity to competitive inhibitors
Buffer compositionOptimize pH and ionic compositionCan significantly affect transport activity and signal-to-noise ratio
TemperatureStandardize across all assaysTransport is temperature-dependent; consistency is crucial

What emerging technologies might advance Slc44a3 research?

Several cutting-edge technologies hold promise for advancing our understanding of Slc44a3 function and regulation:

Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology, enabling determination of high-resolution structures without the need for crystallization. Application of cryo-EM to Slc44a3 could reveal its three-dimensional structure, providing insights into substrate binding sites, conformational changes during transport, and potential drug binding pockets. This structural information would significantly advance rational drug design targeting Slc44a3.

CRISPR-Cas9 genome editing allows precise modification of Slc44a3 in cellular and animal models. This technology enables the creation of knockout models to study loss-of-function effects, introduction of specific mutations to probe structure-function relationships, and tagging of endogenous Slc44a3 for visualization or purification. CRISPR-based approaches also facilitate high-throughput screening of genetic factors that influence Slc44a3 function.

Advanced imaging techniques such as super-resolution microscopy and live-cell imaging with Slc44a3 tagged with fluorescent proteins can reveal dynamic aspects of transporter trafficking, membrane localization, and interactions with other proteins. These approaches provide spatial and temporal information that complements traditional biochemical assays.

Single-cell transcriptomics can identify cell populations that express Slc44a3 within heterogeneous tissues, revealing previously unrecognized expression patterns and potential functional roles. This approach is particularly valuable for understanding Slc44a3 expression in complex tissues like brain, where cellular heterogeneity is high.

How might integrative multi-omics approaches enhance our understanding of Slc44a3 function?

Integrative multi-omics approaches combine different types of large-scale molecular data to provide a comprehensive view of biological systems. For Slc44a3 research, such approaches offer several advantages:

Combining transcriptomics, proteomics, and metabolomics data can reveal how Slc44a3 expression correlates with changes in the broader molecular landscape across different tissues, developmental stages, or disease states. This integrative view can identify potential regulatory networks and metabolic pathways connected to Slc44a3 function.

Functional genomics approaches such as CRISPR screens can identify genes that, when perturbed, affect Slc44a3 expression, localization, or function. These screens can uncover novel regulators of Slc44a3 and potential therapeutic targets for modulating its activity.

Phosphoproteomics analysis can identify post-translational modifications of Slc44a3 that regulate its activity, trafficking, or interactions with other proteins. Understanding these regulatory mechanisms could provide new strategies for therapeutic intervention.

Interactomics studies using techniques such as proximity labeling or co-immunoprecipitation coupled with mass spectrometry can identify proteins that physically interact with Slc44a3. These interaction partners may include regulatory proteins, adaptor proteins involved in trafficking, or components of larger functional complexes.

By integrating these diverse data types, researchers can build comprehensive models of Slc44a3 function within cellular networks, leading to new hypotheses about its physiological roles and potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.