Recombinant Rat CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (St3gal4)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Rat St3gal4 is a soluble or membrane-bound enzyme produced via heterologous expression systems. It facilitates the formation of NeuAc-α2,3-Gal-β1,3-GalNAc or NeuAc-α2,3-Gal-β1,3-GlcNAc sequences on glycoproteins and glycolipids . These structures are implicated in:

  • Inflammatory responses (via sialyl Lewis X epitope synthesis) .

  • Cancer metastasis (downregulation correlates with renal cell carcinoma progression) .

  • Cell adhesion and pathogen recognition .

Recombinant Production

Recombinant Rat St3gal4 is typically expressed in yeast or HEK-293 cells with a His or Strep tag for purification . Key production metrics include:

  • Purity: >90% (yeast-derived) .

  • Yield: Optimized via cell-free systems (e.g., ALiCE®) for post-translational modifications .

  • Activity: Validated using phosphatase-coupled assays (specific activity: 4,000–6,000 pmol/min/μg) .

Specific Activity Calculation

Specific Activity (pmol/min/µg)=Phosphate released (nmol)×1000Incubation time (min)×enzyme amount (µg)\text{Specific Activity (pmol/min/µg)} = \frac{\text{Phosphate released (nmol)} \times 1000}{\text{Incubation time (min)} \times \text{enzyme amount (µg)}}

Derived from linear regression of a phosphate standard curve .

Key Studies

  • Cancer Biology: Reduced St3gal4 mRNA levels are linked to renal cell carcinoma malignancy .

  • Subcellular Localization: Predominantly localized in the trans-Golgi apparatus, with soluble forms generated via proteolytic processing .

  • Inflammatory Pathways: Mediates leukocyte-endothelial interactions through sLeᵡ synthesis .

Comparative Activity in Species

SpeciesHost SystemApplicationReference
RatYeastELISA, functional studies
HumanHEK-293Cancer research
ChimpanzeeYeastStructural studies

Applications

  • ELISA Development: Used as a standard in kits detecting native St3gal4 (e.g., intra-assay CV: 5.03–5.28%) .

  • Glycobiology Studies: Tools for probing sialylation’s role in immune evasion and metastasis .

  • Drug Discovery: Target for inhibitors modulating sialyltransferase activity in cancer .

Technical Considerations

  • Storage: Stable at -20°C in PBS with 50% glycerol .

  • Assay Optimization: Avoid vortexing; dilute in assay buffer to 8 µg/mL for activity measurements .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
St3gal4; Siat4c; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Alpha 2,3-ST 4; Beta-galactoside alpha-2,3-sialyltransferase 4; Alpha 2,3-sialyltransferase IV; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; Gal-beta-1,4-GlcNAc-alpha-2,3-sialyltransferase; N-acetyllactosaminide alpha-2,3-sialyltransferase; ST3Gal IV; ST3GalIV; Sialyltransferase 4C; SIAT4-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
St3gal4
Target Protein Sequence
MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPVSEKKEPCFQGEAERQASKIFGNHSREQPIFLQLKDYFWVKTPSAYELPFGTKGSEDLLLRVLAITSYSIPESIQSLECRRCVVVGNGHRLKNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEAVAIKRMLEMGAVKNLTYF
Uniprot No.

Target Background

Function
Recombinant Rat CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (St3gal4) is a beta-galactoside alpha2-3 sialyltransferase involved in the terminal sialylation of glycoproteins and glycolipids. It catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc- and Galbeta-(1->4)-GlcNAc-terminated glycoconjugates through an alpha2-3 linkage. St3gal4 plays a crucial role in hemostasis. It is responsible for sialylation of plasma VWF/von Willebrand factor, preventing its recognition by asialoglycoprotein receptors (ASGPR) and subsequent clearance. St3gal4 regulates ASGPR-mediated clearance of platelets. Additionally, it participates in the biosynthesis of sialyl Lewis X epitopes, both on O- and N-glycans, which are recognized by SELE/E-selectin, SELP/P-selectin, and SELL/L-selectin. St3gal4 is essential for selectin-mediated rolling and adhesion of leukocytes during extravasation. It contributes to adhesion and transendothelial migration of neutrophils likely through terminal sialylation of CXCR2. In glycosphingolipid biosynthesis, St3gal4 sialylates GM1 and GA1 gangliosides to form GD1a and GM1b, respectively. It metabolizes brain c-series ganglioside GT1c forming GQ1c (Probable). Finally, St3gal4 synthesizes ganglioside LM1 (IV3Neu5Ac-nLc4Cer), a major structural component of peripheral nerve myelin.
Database Links
Protein Families
Glycosyltransferase 29 family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein.

Q&A

What is the primary function of ST3GAL4 in glycan biosynthesis?

ST3GAL4 catalyzes the transfer of sialic acid from CMP-N-acetylneuraminic acid to terminal galactose residues on glycan chains, forming α2,3-linkages. Mass spectrometry analysis has revealed that ST3GAL4 preferentially modifies N-linked glycans rather than O-linked structures . The enzyme contributes to the synthesis of sialylated glycans that serve as ligands for various receptors, including Siglec-9, which plays important roles in immune regulation . ST3GAL4-mediated sialylation affects diverse biological processes including cell adhesion, protein stability, and immune recognition.

How does ST3GAL4 integrate into the cellular sialic acid synthesis pathway?

ST3GAL4 functions as a late-stage enzyme in the sialic acid biosynthetic pathway. In vivo studies using radiolabeled precursors have demonstrated that free N-acetylneuraminic acid (NeuAc) is rapidly synthesized (detectable within 20 seconds after precursor administration) and subsequently activated to CMP-NeuAc with a lag phase of approximately 1 minute . The specific radioactivity of CMP-NeuAc rises above that of free NeuAc, suggesting compartmentalization and preferential channeling of newly synthesized NeuAc molecules to CMP-sialic acid synthetase . Following ST3GAL4-mediated attachment of sialic acid to glycoproteins, approximately 8 minutes are required for transport from the site of sialylation to secretion .

What distinguishes ST3GAL4 from other sialyltransferases in the ST3GAL family?

Despite structural similarities with other ST3GAL family members, ST3GAL4 exhibits distinct substrate preferences and biological functions. CRISPR knockout studies have demonstrated that ST3GAL3, a closely related sialyltransferase, does not affect Siglec-9 ligand expression in AML cell lines, while ST3GAL4 knockout dramatically reduces these ligands . This functional specificity likely derives from subtle differences in substrate recognition sites within the enzyme's catalytic domain. The distinct physiological roles are further evidenced by knockout phenotypes—ST3GAL4 knockout mice exhibit primarily mild platelet function deficiencies, suggesting limited functional redundancy with other sialyltransferases in most physiological contexts .

What are the most effective methods for generating and validating ST3GAL4 knockout models?

CRISPR-Cas9 genome editing represents the gold standard for generating ST3GAL4 knockout models. A comprehensive protocol includes:

  • Design of sgRNAs targeting conserved exons of ST3GAL4 (typically early exons to ensure complete functional disruption)

  • Cloning sgRNAs into appropriate vectors (e.g., LentiCRISPR-v2)

  • Lentiviral transduction of target cells with viral media containing 8 μg/ml polybrene

  • Selection with puromycin (1 μg/mL) for 48-72 hours post-transduction

  • Validation of editing efficiency through:

    • Genomic DNA extraction and Sanger sequencing of the target region

    • TIDE analysis to quantify indel formation (frameshift mutations)

    • Functional validation using Siglec-9-Fc chimera staining to assess loss of sialylated ligands

Successful knockout typically shows >70% editing efficiency with corresponding reductions in Siglec-9 binding .

What approaches are recommended for ST3GAL4 overexpression studies?

For overexpression studies, researchers have successfully employed the following protocol:

  • Subcloning the full-length ST3GAL4 cDNA into expression vectors (pcDNA3.1 for transient/stable transfection or pLentiTwist for lentiviral delivery)

  • Transfection using Lipofectamine 2000 for adherent cells or electroporation for suspension cells

  • Selection of stable transfectants using G418 (600-800 μg/ml depending on cell line)

  • Validation of overexpression by:

    • RT-PCR for mRNA expression

    • Western blot for protein expression

    • Lectin blot to confirm increased sialylation

    • MALDI-TOF MS/MS to analyze changes in glycan profiles

Successful overexpression should yield significant increases in sialylated glycan structures, particularly those containing α2,3-linked sialic acids .

How can researchers analyze the specific glycan structures affected by ST3GAL4 modulation?

Comprehensive glycan analysis requires multiple complementary approaches:

What phenotypes emerge from ST3GAL4 knockout in different biological contexts?

ST3GAL4 knockout produces context-dependent phenotypes:

  • Whole organism: ST3GAL4 knockout mice are viable and exhibit primarily mild deficiencies in platelet function, suggesting redundancy or compensatory mechanisms in most physiological systems .

  • Hematopoietic cells: In acute myeloid leukemia (AML) cell lines, ST3GAL4 knockout dramatically reduces Siglec-9 ligand expression and enhances susceptibility to phagocytosis by Siglec-9-expressing macrophages, indicating a role in immune evasion .

  • Glycan profile: Mass spectrometry analysis of ST3GAL4 knockout cells reveals substantial reductions in α2,3-sialylated N-linked glycans, with particular impact on structures that serve as Siglec-9 ligands .

The relatively mild phenotype in knockout mice suggests that ST3GAL4 could potentially be targeted therapeutically without causing severe systemic effects .

How does ST3GAL4 contribute to tumor biology in different cancer types?

ST3GAL4 exhibits striking context-dependent roles in cancer:

  • Acute Myeloid Leukemia (AML):

    • Upregulated in several AML subtypes compared to normal hematopoietic cells

    • Promotes immune evasion by generating Siglec-9 ligands that inhibit macrophage phagocytosis

    • Associated with worse survival in AML patient cohorts

    • May also synthesize Sialyl Lewis X antigens that facilitate AML stem cell survival in the bone marrow niche

  • Cervical Cancer:

    • Downregulated in cervical cancer tissues compared to normal cervix

    • Overexpression inhibits proliferation and colony formation in HeLa and SiHa cells

    • Induces S-phase cell cycle arrest via the Notch1/p21/CDKs pathway

    • Suppresses tumor growth in xenograft models

These contradictory roles highlight the context-specific functions of sialylated glycans in different tumor microenvironments and signaling networks.

What molecular pathways are modulated by ST3GAL4 activity?

ST3GAL4 affects distinct molecular pathways in different cellular contexts:

  • Immune regulation pathway: In AML, ST3GAL4-generated sialic acid ligands engage the inhibitory receptor Siglec-9 on immune cells, suppressing phagocytosis and anti-tumor immunity .

  • Notch signaling pathway: In cervical cancer cells, ST3GAL4 overexpression activates the Notch1 signaling pathway, leading to:

    • Increased expression of Jagged1, Notch1, Hes1, and Hey1

    • Upregulation of p21, a cell cycle inhibitor

    • Decreased expression of cell cycle regulators including CyclinD1, CyclinE1, CDK2, and CDK4

    • S-phase cell cycle arrest and reduced proliferation

  • Adhesion pathways: ST3GAL4 synthesizes ligands for selectins, particularly E-selectin, which mediates cell adhesion and potentially influences cancer stem cell interactions with the microenvironment .

The cell-type specific effects may reflect differences in the glycoprotein substrates available for sialylation or in the downstream effectors that recognize sialylated structures.

How do researchers address the conflicting roles of ST3GAL4 in different cancer types?

The paradoxical roles of ST3GAL4 across cancer types present significant research challenges. Methodological approaches to reconcile these findings include:

  • Comprehensive glycomic profiling: Detailed mass spectrometry analysis of the specific glycan structures affected in each context can reveal whether ST3GAL4 modifies different glycoprotein substrates in different cell types .

  • Protein-specific glycosylation analysis: Identifying the key carrier proteins that bear ST3GAL4-dependent glycans in each context may explain divergent functional outcomes.

  • Signaling network analysis: The impact of sialylation likely depends on the pre-existing signaling network architecture in each cell type. Pathway analysis and phosphoproteomic profiling can identify context-specific signaling responses.

  • Receptor engagement studies: Different glycan-binding receptors (Siglecs, selectins, etc.) may predominate in different tissues, leading to distinct functional outcomes despite similar glycan modifications.

  • Transcriptomic correlation analysis: Analyzing correlations between ST3GAL4 and other glycosyltransferases or glycan-binding proteins across cancer types can identify critical co-factors that determine functional outcomes.

These approaches collectively provide a systems-level view of how identical biochemical activities can yield opposite biological effects in different cellular contexts.

What are the emerging therapeutic approaches targeting ST3GAL4 or its products?

Several therapeutic strategies targeting ST3GAL4 are under investigation:

  • Direct enzyme inhibition: Small molecule inhibitors of ST3GAL4 could reduce sialylation of cancer cell surfaces, enhancing immune recognition. The mild phenotype of ST3GAL4 knockout mice suggests potential for a favorable safety profile .

  • Siglec-targeting approaches: Antibodies that block Siglec-9 or other Siglecs could prevent recognition of ST3GAL4-generated ligands, potentially enhancing anti-tumor immunity without directly inhibiting the enzyme.

  • Combination with immunotherapy: ST3GAL4 inhibition could synergize with existing immunotherapies by removing inhibitory signals that dampen immune cell functions.

  • Selectin pathway inhibition: In AML, an E-selectin inhibitor targeting the ST3GAL4-dependent selectin ligand pathway is currently in clinical trials .

  • Context-specific approaches: The opposing roles of ST3GAL4 in different cancers necessitate careful selection of appropriate cancer types for inhibition strategies versus potential enhancement approaches.

Preclinical validation requires humanized mouse models due to differences in Siglec expression and binding specificity between humans and mice .

What technical challenges must be overcome for effective in vivo study of ST3GAL4 function?

Several technical challenges complicate the in vivo study of ST3GAL4:

  • Species-specific differences in glycan recognition: The specificity of human Siglec-9 differs from its mouse homolog Siglec-E, necessitating humanized models for translational studies. The degree of conservation between these receptors remains incompletely characterized .

  • Analytical complexity of glycan structures: Unambiguous identification of specific glycan structures in tissues requires specialized analytical approaches that preserve spatial information while providing detailed structural characterization.

  • Temporal dynamics of glycosylation: The rapid turnover of cell surface glycoproteins and their glycan modifications creates challenges for capturing the dynamic nature of ST3GAL4 activity in vivo.

  • Functional redundancy: Multiple sialyltransferases with overlapping substrate specificity may compensate for ST3GAL4 deficiency in certain contexts, masking phenotypes in knockout models.

  • Context-dependence of glycan function: The same sialylated glycan structure may interact with different binding partners depending on the tissue context, complicating interpretation of phenotypic data.

Advanced approaches including tissue-specific conditional knockout models, glycan imaging technologies, and systems biology approaches integrating multiple omics datasets will be necessary to fully elucidate ST3GAL4 function in complex in vivo settings.

How might single-cell analysis enhance our understanding of ST3GAL4 biology?

Single-cell approaches offer transformative potential for ST3GAL4 research:

  • Single-cell glycomics: Emerging technologies for single-cell glycan analysis could reveal heterogeneity in ST3GAL4 activity within cell populations, potentially identifying specific cellular subsets where ST3GAL4 plays critical roles.

  • Integrated single-cell multi-omics: Correlating glycan profiles with transcriptomic and proteomic data at single-cell resolution could identify the key molecular determinants that dictate whether ST3GAL4 promotes or inhibits cancer progression in specific contexts.

  • Spatial glycomics: Combining single-cell analysis with spatial information could reveal microenvironmental influences on ST3GAL4 function, particularly in the context of immune cell interactions within the tumor microenvironment.

  • Lineage tracing with glycan reporters: Developing reporter systems that track ST3GAL4 activity through cell lineages could reveal developmental or differentiation-dependent regulation of enzyme activity.

These approaches may help resolve the apparent contradictions in ST3GAL4 function by revealing previously unappreciated heterogeneity in its cellular roles.

What structural biology approaches could advance ST3GAL4 research?

Structural biology offers several promising avenues for ST3GAL4 research:

  • Enzyme-substrate complex structures: High-resolution structures of ST3GAL4 in complex with donor (CMP-NeuAc) and acceptor substrates could reveal the molecular basis for its N-glycan preference and guide the design of specific inhibitors.

  • Structure-based inhibitor design: Computational approaches leveraging structural information could accelerate the development of selective ST3GAL4 inhibitors with potential therapeutic applications.

  • Structural comparison with related enzymes: Detailed structural comparisons between ST3GAL4 and other ST3GAL family members could identify the specific features that determine their distinct substrate preferences despite high sequence similarity.

  • Conformational dynamics: Techniques such as hydrogen-deuterium exchange mass spectrometry could reveal dynamic aspects of ST3GAL4 function, including potential allosteric regulation mechanisms.

  • Glycoprotein-Siglec complexes: Structural studies of Siglec-9 in complex with ST3GAL4-modified glycoproteins could provide insights into the molecular basis for immune recognition and evasion.

These structural insights would provide a molecular framework for understanding the biochemical functions of ST3GAL4 and their translation to biological outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.