Recombinant Rat Coiled-coil domain-containing protein 51 (Ccdc51)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ccdc51; Mitok; Mitochondrial potassium channel; MITOK; Coiled-coil domain-containing protein 51
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ccdc51
Target Protein Sequence
MTGCSPVFTMQQVVGVSHRLVWRTFRGTDLLMTRTLCSPGPSRPGEKRPEAAALGLYHRL PELGRTLSHTIRNQAASTAKAWWDRYEEFVGLNEVREAQGNVTEAEKVFMVARGLVREAR EDLEAQQTKLKEVRDRLDRVSREDNQYLELATLEHRMLQEEKRLRIAYLRAEDSEREKFS LFSAAVRESHEKERTRAERTKNWSLIGSVLGALIGVAGSTYVNRVRLQELKALLLEAQKG PVSLQEAIREQASSYSLQQKDLQNLMVDLRGLVHVGQDQGSGSPTGPSSPRGKDIDGLSA AMKEQLNHSRQVYSCLEGLREQLDSLEKTCSQMAGVVRLAKVPAHPGMVEPLDGALPSSL LEHGSTMLALSEMEQRLEAQANRNAISSTLVTCVTFMATLPLLYMLFKTS
Uniprot No.

Target Background

Function
Recombinant Rat Coiled-coil domain-containing protein 51 (Ccdc51) is a mitochondrial potassium channel residing in the inner mitochondrial membrane. It forms a protein complex with ABCB8/MITOSUR, localized within the mitochondria, mediating ATP-dependent potassium currents across the inner membrane (the mitoK(ATP) channel). This protein may regulate cellular metabolism under stress conditions by modulating mitochondrial matrix volume, contributing to homeostatic control.
Database Links

KEGG: rno:316008

UniGene: Rn.11428

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Rat Ccdc51 in mitochondrial physiology?

Rat Ccdc51 (also known as MITOK) functions as the pore-forming subunit of the mitochondrial ATP-gated potassium channel (mitoK(ATP)). According to molecular characterization studies, it works in conjunction with the ATP-binding subunit ABCB8/MITOSUR to mediate ATP-dependent K+ currents across the mitochondrial inner membrane . The protein responds to cellular ATP levels, with increased ATP concentrations closing the channel (inhibiting K+ transport) and decreased ATP levels enhancing K+ uptake into the mitochondrial matrix, contributing to homeostatic control of cellular metabolism under stress conditions .

How conserved is Ccdc51 between rat and other mammalian species?

Sequence analysis reveals high conservation of Ccdc51 across mammalian species. Specifically, the rat Ccdc51 protein shares approximately:

  • 95% amino acid sequence identity with mouse Ccdc51 in the region spanning amino acids 91-219

  • 77% amino acid sequence identity with human Ccdc51 in the region spanning amino acids 226-371

This high degree of conservation suggests evolutionary importance of the protein's function across mammalian species, particularly in mitochondrial potassium channel activity regulation .

What are the recommended experimental conditions for handling recombinant Rat Ccdc51 protein?

For optimal stability and activity of recombinant Rat Ccdc51:

  • Store the protein at 4°C for short-term use

  • For long-term storage, maintain at -20°C with proper aliquoting to avoid repeated freeze-thaw cycles

  • When using in blocking experiments, a 100x molar excess of the protein fragment is recommended

  • Pre-incubate antibody-protein mixtures for 30 minutes at room temperature before experimental use

  • Use PBS buffer with pH 7.5 containing 40% glycerol and 0.02% sodium azide for protein stability

How can I validate the specificity of antibodies against Rat Ccdc51 in my experiments?

A systematic approach to validating anti-Ccdc51 antibodies includes:

  • Positive and negative tissue controls: Use tissues known to express Ccdc51 at high levels (enriched mitochondrial preparations) and those with minimal expression

  • Recombinant protein blocking: Pre-incubate your antibody with recombinant Ccdc51 control fragments (available for different domains, e.g., aa 91-219 or aa 226-371) at a 100x molar excess. Compare immunoreactivity with and without blocking

  • Multiple antibody validation: Employ antibodies targeting different epitopes of Ccdc51 to confirm consistent localization patterns

  • Western blot analysis: Verify single band detection at the expected molecular weight (~45.132 kDa for mouse Ccdc51)

  • Knockout/knockdown controls: When available, utilize Ccdc51-knockout or siRNA-mediated knockdown samples as negative controls

What experimental approaches are recommended for studying Ccdc51 interactions with other mitochondrial proteins?

To investigate Ccdc51 protein interactions:

  • Co-immunoprecipitation (Co-IP): Pull down Ccdc51 using specific antibodies and identify interacting partners by Western blot or mass spectrometry, particularly focusing on ABCB8/MITOSUR which forms the complete mitoK(ATP) channel

  • Proximity labeling: Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to Ccdc51 within the mitochondrial inner membrane

  • FRET/BRET analysis: For studying dynamic interactions between Ccdc51 and potential partners

  • Crosslinking mass spectrometry: To capture transient interactions within the mitochondrial membrane environment

  • Yeast two-hybrid screening: As a complementary approach, though care must be taken with membrane proteins

How does Rat Ccdc51 contribute to mitochondrial morphology regulation?

Recent research indicates Ccdc51 plays a crucial role in mitochondrial morphology maintenance:

  • Time-lapse microscopy has spatially and temporally resolved Ccdc51 to a subset of mitochondrial fission events

  • Altered CCDC51 expression levels directly affect mitochondrial fission dynamics, suggesting involvement in the physical processes of membrane remodeling

  • Functional conservation between human CCDC51 and yeast Mdm33 (demonstrated through rescue experiments) suggests an evolutionarily preserved role in maintaining normal mitochondrial morphology

  • Both proteins appear to function as mediators of mitochondrial dynamics and organelle homeostasis, influencing the balance between fission and fusion events

What are the technical challenges in distinguishing between the role of Ccdc51 in potassium transport versus its role in mitochondrial morphology?

This represents a significant challenge requiring sophisticated experimental design:

  • Domain-specific mutants: Generate recombinant Rat Ccdc51 variants with mutations in:

    • Pore-forming domains (affecting K+ conductance without disrupting structural integrity)

    • Protein-protein interaction domains (affecting morphology regulation)

  • Real-time simultaneous measurements: Combine:

    • Potassium-sensitive fluorescent probes (e.g., PBFI) to monitor K+ flux

    • Mitochondrial morphology tracking (e.g., MitoTracker with super-resolution microscopy)

  • Temporal resolution: Employ optogenetic tools for precise temporal control of Ccdc51 activity to determine which function (K+ transport or morphology regulation) is primary versus secondary

  • Pharmacological approaches: Use specific potassium channel blockers to isolate morphological functions from ion transport functions

  • Reconstitution experiments: Utilize artificial membrane systems with purified recombinant proteins to assess potassium channel activity independent of cellular morphological machinery

How do post-translational modifications affect Rat Ccdc51 function in different physiological and stress conditions?

This represents an emerging research area with several critical considerations:

  • Phosphorylation analysis: Mouse proteomics studies have identified phosphorylation sites on Ccdc51 , suggesting potential regulatory mechanisms. Researchers should:

    • Map corresponding phosphorylation sites in Rat Ccdc51

    • Generate phosphomimetic and phospho-null mutants

    • Analyze channel activity and mitochondrial morphology under different conditions

  • Stress response modifications: Examine:

    • Oxidative stress-induced modifications (carbonylation, S-nitrosylation)

    • Hypoxia-associated modifications

    • Metabolic stress responses

  • Methodological approaches:

    • Mass spectrometry to identify and quantify modifications

    • Site-directed mutagenesis to assess functional impact

    • In vitro reconstitution with modified proteins

    • Correlation of modifications with mitochondrial functional parameters

What are the implications of the evolutionary relationship between Rat Ccdc51 and yeast Mdm33 for studying mitochondrial dynamics across species?

The functional conservation between CCDC51 and Mdm33 has significant research implications:

  • Complementation strategies: The ability of CCDC51 to partially rescue Δmdm33 yeast cells enables:

    • Structure-function mapping across evolutionarily distant species

    • Identification of conserved versus divergent functional domains

    • Use of yeast as a simplified model system for initial studies

  • Mechanistic investigations: Key research directions include:

    • Determining if both proteins interact with homologous partners

    • Comparing their roles in mitochondrial fission machinery

    • Assessing whether both proteins respond similarly to metabolic signals

  • Experimental design considerations:

    • Creation of chimeric proteins to identify functionally important domains

    • Comparative proteomic analysis of interaction partners

    • Cross-species rescue experiments with domain-specific mutants

What are the optimal expression systems for producing high-quality recombinant Rat Ccdc51 protein for structural and functional studies?

Several expression systems can be considered, each with advantages:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, cost-effective, rapid expressionMay lack proper folding for membrane proteinsUse specialized strains (e.g., C41/C43), fusion tags (MBP), lower induction temperature
Mammalian cells (HEK293)Proper folding, post-translational modificationsLower yield, higher costOptimize codon usage, use inducible systems, screen stable cell lines
Insect cellsGood compromise between yield and proper foldingRequires baculovirus generationOptimize MOI, harvest timing, consider Sf9 vs. High Five cells
Cell-free systemsAvoids toxicity issues, rapidExpensive, may require membrane mimeticsSupplement with chaperones, optimize redox conditions

For functional studies, mammalian expression systems are generally preferred due to proper folding and post-translational modifications of mitochondrial membrane proteins .

How can I effectively study the impact of Ccdc51 on mitochondrial membrane potential and related physiological parameters?

A comprehensive approach includes:

  • Membrane potential measurements:

    • Use potentiometric dyes (TMRM, JC-1) with careful calibration

    • Implement patch-clamp electrophysiology on isolated mitochondria

    • Consider real-time analysis in intact cells versus isolated organelles

  • Experimental design controls:

    • Include known K+ channel activators (diazoxide) and blockers (5-HD)

    • Compare wild-type, overexpression, and knockdown/knockout models

    • Use synchronized measurements of multiple parameters

  • Related parameters to measure:

    • ATP production (luciferase-based assays)

    • Mitochondrial Ca2+ handling (targeted Ca2+ indicators)

    • ROS production (MitoSOX, DCF-DA)

    • Mitochondrial swelling (light scattering)

  • Technical considerations:

    • Account for potential artifacts due to probe loading

    • Maintain consistent experimental conditions (temperature, pH)

    • Validate findings across multiple techniques

What strategies can address the challenges in differentiating the specific functions of Ccdc51 from those of other mitochondrial potassium channels?

This represents a significant technical challenge requiring:

  • Precise genetic manipulation:

    • Generate conditional knockout models with temporal control

    • Use CRISPR/Cas9 for specific targeted mutations

    • Employ inducible expression systems for controlled studies

  • Pharmacological approaches with limitations awareness:

    • Recognize that most K+ channel modulators lack absolute specificity

    • Use combinations of activators/inhibitors with different selectivity profiles

    • Implement concentration-response analyses to identify specific effects

  • Biophysical characterization:

    • Employ electrophysiological techniques with reconstituted channels

    • Conduct ion selectivity studies to distinguish channel properties

    • Use single-channel recordings when possible

  • Comparative studies:

    • Systematically compare properties with other mitochondrial K+ channels (mitoKATP, mitoKCa, mitoTASK)

    • Assess differential responses to physiological and pathological stimuli

    • Examine tissue-specific expression and function patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.