Recombinant Rat Complement component C9 (C9)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. To prioritize a specific tag, please inform us during your order.
The specific tag type will be determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
C9; Complement component C9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-554
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
QAPEPTPREEPSADALLPIDCRMSTWSQWSQCDPCLKQRFRSRSIEVFGQFQGKSCADAL
GDRQHCEPTQECEEVQENCGNDFQCETGRCIKRKLLCNGDNDCGDFSDESDCESDPRLPC
RDRVVEESELGRTAGYGINILGMDPLGTPFDNEFYNGLCDRVRDGNTLTYYRKPWNVAFL
AYETKADKNFRTENYEEQFEMFKTIVRDRTTSFNANLALKFTITEAPIKKVGVDEVSPEK
NSSKPKDSSVDFQFSYFKKENFQRLSSYLSQTKKMFLHVKGMIQLGRFVMRNRGVMLTTT
FLDDVKALPVSYEKGEYFGFLETYGTHYSSSGSLGGLYELIYVLDKASMKEKGVELSDVK
RCLGFNLDVSLYTPLQTALEGPSLTANVNHSDCLKTGDGKVVNISRDHIIDDVISFIRGG
TRKQAVLLKEKLLRGAKTIDVNDFINWASSLDDAPALISQKLSPIYNLIPLTMKDAYAKK
QNMEKAIEDYVNEFSARKCYPCQNGGTAILLDGQCMCSCTIKFKGIACEISKQR
Uniprot No.
Target Background
Function
A component of the membrane attack complex (MAC), C9 plays a crucial role in both innate and adaptive immune responses by forming pores in target cell plasma membranes. It is the pore-forming subunit of the MAC.
Gene References Into Functions
- This study identifies ASK1 as a novel mediator of C5b-9-dependent cell injury. PMID: 18178252
- The complement membrane attack complex induces caspase activation and apoptosis. PMID: 11870622
Database Links
Protein Families
Complement C6/C7/C8/C9 family
Subcellular Location
Secreted. Target cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in blood serum (at protein level).
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
