Recombinant Rat coronavirus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Rat coronavirus (strain NJ) (RCV-NJ)
Target Names
M
Target Protein Sequence
APQTVYEWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSMFIYVVKMIILWLMWPL TIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIMYFVNSIRLFIRTGSWWSFNPETNNLM CIDVKGTVYVRPIIEDYHTLTATNVRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTY KRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGVDTALLRI
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through its interactions with other viral proteins.
Protein Families
Coronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the basic structural organization of the rat coronavirus M protein?

The rat coronavirus M protein, similar to other coronavirus M proteins, is predicted to contain a triple-spanning transmembrane (TM) region with an N-terminal domain positioned in the exterior of the virion and a long C-terminal region in the interior. The protein typically features an N-glycosylation site near its N-terminus and exhibits high hydrophobicity in its transmembrane domains. The protein's structure includes discrete regions with distinctive physical properties - the exterior N-terminal region, the transmembrane segments, and the C-terminal interior domain which is characterized by higher hydrophilicity and positive charge distribution . M protein is approximately 220-221 amino acids in length with a molecular weight of approximately 25 kDa, depending on the specific coronavirus strain.

What functional roles does the M protein play in rat coronavirus biology?

The M protein serves multiple critical functions in coronavirus biology. It acts as the core membrane protein responsible for viral assembly and morphogenesis by promoting the packaging of genomic RNA into viral particles . It mediates interactions with other structural proteins, particularly the S (spike), E (envelope), and N (nucleocapsid) proteins. The C-terminal interior region, with its high pI value (approximately 9.80) and hydrophilicity (45.5%), facilitates these protein-protein interactions essential for virion formation . Additionally, the M protein likely contributes to viral infectivity through binding to the viral S protein and host surface receptors, thereby promoting membrane fusion during viral entry into host cells .

How conserved is the M protein among different rat coronavirus strains compared to other coronaviruses?

Analysis of coronavirus M proteins reveals several conserved motifs, particularly a segment located between approximately codons 94 and 114, which is the most conserved (70-100% consensus) motif among all coronaviruses . This region, partially overlapping with the interior membrane boundary of the third transmembrane domain, is suggested to be involved in interactions with the N protein and viral RNA. Phylogenetic analyses of rodent coronaviruses such as RCoV-GCCDC3 and RCoV-GCCDC4 show they belong to the Betacoronavirus genus lineage A, while others like RCoV-GCCDC5 belong to the Alphacoronavirus genus . These evolutionary relationships help researchers understand potential recombination events and functional adaptations of the M protein across different viral strains.

What expression systems are most effective for producing recombinant rat coronavirus M protein?

  • Mammalian expression systems (HEK293, CHO cells) when glycosylation patterns are critical

  • Baculovirus-insect cell systems (Sf9, High Five) which provide higher yields while maintaining most post-translational modifications

  • Yeast systems (Pichia pastoris) for intermediate-scale production

The choice depends on experimental requirements, with mammalian systems best reproducing the natural glycosylation at the N-terminal site identified in coronavirus M proteins . When designing expression constructs, researchers should consider adding affinity tags (His6, FLAG) to the C-terminus rather than the N-terminus to avoid interfering with the N-terminal glycosylation site that is important for proper folding and function.

What are the optimal solubilization and purification strategies for recombinant M protein?

Purification of recombinant M protein presents challenges due to its hydrophobic transmembrane domains. A methodological approach includes:

  • Cell lysis: Use gentle detergent-based methods rather than sonication to preserve protein structure

  • Membrane fraction isolation: Perform differential centrifugation (10,000×g followed by 100,000×g ultracentrifugation)

  • Solubilization: Test multiple detergents including:

    • DDM (n-Dodecyl β-D-maltoside): 1-2% for initial solubilization

    • LMNG (Lauryl maltose neopentyl glycol): 0.5-1% for improved stability

    • SDS: Only if denaturing conditions are acceptable

  • Purification sequence:

    • IMAC (immobilized metal affinity chromatography) using His-tag if incorporated

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography exploiting the basic pI (approximately 9.3) of the M protein

For structural studies, consider amphipol or nanodisc reconstitution following purification to maintain native-like membrane environment. Purity assessment should utilize SDS-PAGE with western blotting using anti-M antibodies, as the hydrophobic nature of M protein can cause anomalous migration patterns on gels.

What strategies can overcome poor expression yields of recombinant M protein?

Poor expression yields are common when producing membrane proteins like the coronavirus M protein. To address this challenge:

  • Codon optimization: Adjust the coding sequence for the expression host's codon bias

  • Expression temperature modulation: Lower temperature (16-20°C) during induction phase reduces inclusion body formation

  • Fusion partners: Consider fusion with solubility-enhancing tags such as:

    • MBP (maltose-binding protein)

    • SUMO (small ubiquitin-like modifier)

    • Thioredoxin

  • Growth and induction optimization:

    • Test various induction OD values (typically 0.6-0.8)

    • Titrate inducer concentration (IPTG: 0.1-1.0 mM)

    • Extend expression time at lower temperatures (24-48 hours)

  • Truncation strategies: Express functional domains separately if full-length expression fails, particularly focusing on the C-terminal interior region which contains most of the antigenic sites

Monitor expression levels via western blot rather than relying solely on total protein quantification methods, as membrane proteins often express at lower levels than soluble proteins but may still yield sufficient material for downstream applications.

How can researchers verify proper folding and post-translational modifications of recombinant M protein?

Verification of proper folding and post-translational modifications requires multiple complementary approaches:

  • Glycosylation analysis:

    • PNGase F treatment followed by mobility shift assay on SDS-PAGE

    • Lectin blotting to confirm glycan structures

    • Mass spectrometry analysis of glycopeptides to identify exact glycosylation sites

  • Secondary structure assessment:

    • Circular dichroism (CD) spectroscopy to evaluate α-helical content expected from transmembrane domains

    • FTIR spectroscopy for additional secondary structure information

  • Functional assays:

    • Membrane integration assays using liposome reconstitution

    • Protein-protein interaction studies with other viral components (S, E, N proteins)

  • Antibody recognition tests:

    • Conformational antibody binding assays using antibodies raised against native viral M protein

    • Comparison with synthetic peptide ELISA results from patient sera to verify antigenic profile

The experimental validation should focus particularly on the N-glycosylation site near the N-terminus and proper folding of the triple-spanning transmembrane regions, as these are critical for authentic M protein structure and function.

What techniques are most effective for studying M protein interactions with other viral components?

Understanding M protein interactions with other viral components is crucial for elucidating its role in viral assembly and infectivity. Effective methodological approaches include:

  • Co-immunoprecipitation (Co-IP):

    • Express recombinant M protein with differentially tagged viral proteins (S, E, N)

    • Perform reciprocal pull-downs to confirm binding

    • Use crosslinking to capture transient interactions

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI):

    • Immobilize purified M protein in detergent micelles or nanodiscs

    • Measure binding kinetics with other viral proteins

    • Determine affinity constants (KD) for each interaction

  • Proximity-based techniques:

    • FRET (Förster resonance energy transfer) with fluorescently labeled proteins

    • PLA (proximity ligation assay) in cell-based systems

    • BioID or APEX2 proximity labeling in living cells

  • Cryo-electron microscopy:

    • Visualize M protein organization within virus-like particles

    • Map interaction interfaces at near-atomic resolution

Research suggests that the M protein's C-terminal interior region contains phosphorylation sites (TSR at codon 171, SQR at 183) that might regulate interactions with the S, E, and N proteins . Additionally, the highly conserved segment between codons 94-114 appears critical for interaction with the N protein and viral RNA . Systematic mutation of these regions combined with interaction assays can provide mechanistic insights into M protein function in coronavirus assembly.

What biophysical methods best characterize the membrane topology of recombinant M protein?

Determining the precise membrane topology of the rat coronavirus M protein requires complementary biophysical approaches:

  • Protease protection assays:

    • Reconstitute purified M protein in liposomes

    • Treat with proteases (trypsin, proteinase K) under controlled conditions

    • Analyze protected fragments by mass spectrometry to map membrane-embedded regions

  • Fluorescence spectroscopy:

    • Introduce single cysteine residues at strategic positions

    • Label with environment-sensitive fluorophores

    • Measure accessibility and local environment of specific regions

  • EPR (electron paramagnetic resonance) spectroscopy:

    • Spin-label specific residues across the protein

    • Measure accessibility parameters and immersion depth

    • Generate detailed topology maps of transmembrane segments

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Monitor deuterium uptake across the protein sequence

    • Identify protected regions corresponding to membrane-embedded domains

    • Map solvent-exposed regions

Based on predictions and experimental evidence from related coronaviruses, the M protein likely has its N-terminus in the exterior of the virion and its C-terminus in the interior, with three transmembrane segments creating this orientation . The predicted signal peptide shares structural and positional features with M proteins from other coronaviruses, though questions remain about whether it is actually cleaved and released .

How does recombinant rat coronavirus M protein compare structurally and functionally with SARS-CoV and SARS-CoV-2 M proteins?

Comparative analysis of rat coronavirus M protein with SARS-CoV and SARS-CoV-2 M proteins reveals both conserved features and distinct differences:

FeatureRat Coronavirus MSARS-CoV MSARS-CoV-2 M
Size (amino acids)~221221222
Transmembrane domainsTriple-spanningTriple-spanningTriple-spanning
N-glycosylationPresent near N-terminusPresent near N-terminusPresent near N-terminus
pI value~9.39.63~9.5
Hydrophobicity (%)~40-41%40.70%~41%
Conserved motifsYFV-S-L-R-TSMWSFNPEYFV-S-L-R-TSMWSFNPESimilar with variations
AntigenicityPrimarily in C-terminal regionSegments 1-20, 137-157, 189-211, 206-221Similar pattern

Phylogenetic analyses place rat coronaviruses like RCoV-GCCDC3 and RCoV-GCCDC4 in the Betacoronavirus genus lineage A, distinct from the lineage B that includes SARS-CoV and SARS-CoV-2 . Despite these evolutionary differences, the M proteins share core structural and functional properties, including their role in viral assembly and interaction with other structural proteins. The most significant differences typically occur in the exterior N-terminal region, which faces different selective pressures related to host immune recognition.

What insights can recombination analysis of rat coronavirus genomes provide about M protein evolution?

Recombination analysis of rat coronavirus genomes offers valuable insights into M protein evolution and potential cross-species transmission risks:

  • Potential recombination events:

    • Recent studies identified RCoV-GCCDC4 as a potentially recombinant coronavirus involving murine hepatitis virus (MHV) and Longquan Rl rat coronavirus (LRLV)

    • Similarity plots indicated a putative recombination site at nucleotide position ~20,170, separating the genome into two regions with different evolutionary histories

    • The structural and accessory gene region (including M gene) showed 95.3% similarity to LRLV but only 81.6% similarity to MHV-1

  • Methodological approach to detect recombination:

    • Genome alignment using MAFFT or similar tools

    • Similarity plot analysis using SimPlot

    • Recombination detection using RDP4 software with multiple algorithms (RDP, GENECONV, Bootscan, MaxChi, Chimaera, SiScan, and 3Seq)

    • Phylogenetic analyses of individual genes versus whole genomes

  • Evolutionary implications:

    • Recombination events can introduce novel functional properties to the M protein

    • The higher substitution rate observed in coronavirus M proteins (0.6% correlated to size) provides genetic flexibility

    • Non-synonymous changes in the M protein can be classified into types that affect: pI and charge (altering antigenicity), hydrophobicity of TM regions, or hydrophilicity of interior structures

These findings underscore the importance of surveillance for potentially recombinant coronaviruses in rodent populations, as they may represent stepping stones for viral adaptation and potential zoonotic transmission.

What methodologies can detect structural changes in M protein associated with viral recombination events?

Detecting structural changes in M protein resulting from recombination events requires sophisticated analytical approaches:

  • Comparative structural predictions:

    • Generate 3D structural models using AlphaFold or RoseTTAFold

    • Compare predicted structures before and after putative recombination events

    • Identify regions with significant structural alterations

  • Epitope mapping and antigenic profiling:

    • Develop panels of monoclonal antibodies targeting different M protein domains

    • Compare binding profiles between parental and recombinant viruses

    • Identify altered epitopes using competitive ELISA or epitope binning

  • Functional assays to detect phenotypic changes:

    • Membrane fusion assays comparing parental and recombinant M proteins

    • Protein-protein interaction studies with other viral components

    • Cell-cell fusion efficiency measurements in overexpression systems

  • Mass spectrometry-based structural analysis:

    • Hydrogen-deuterium exchange patterns to detect conformational differences

    • Cross-linking mass spectrometry to map interaction interfaces

    • Limited proteolysis coupled with mass spectrometry to identify altered accessible regions

Recombination events can particularly affect the exterior N-terminal region and transmembrane domains, potentially altering glycosylation patterns, membrane topology, or interaction with host factors. Changes in the conserved YFV-S-L-R-TSMWSFNPE motif or the PETNILLNVP segment may have significant functional consequences, as these regions are implicated in interactions with other viral proteins and potentially with host factors .

What are the most immunogenic regions of rat coronavirus M protein and how should researchers design experiments to identify them?

Identifying immunogenic regions of rat coronavirus M protein requires systematic experimental approaches:

  • Epitope mapping strategy:

    • Synthesize overlapping peptides (15-20 amino acids) covering the entire M protein sequence

    • Test each peptide by ELISA using sera from infected animals or immunized models

    • Verify results with confirmatory assays such as peptide arrays or phage display

  • Experimental design considerations:

    • Include both linear and conformational epitope detection methods

    • Use multiple animals/samples to account for individual variability

    • Compare results from natural infection versus recombinant protein immunization

  • Expected results based on coronavirus M protein studies:

    • The exterior N-terminal region (approximately amino acids 1-20) is typically highly immunogenic

    • Several segments in the C-terminal interior region (e.g., 137-157, 189-211, 206-221) show strong reactivity with antibodies

    • Hydrophobic transmembrane regions generally show poor immunoreactivity

When designing these experiments, researchers should prepare controls carefully, including pre-immune sera and irrelevant peptides of similar physicochemical properties. Additionally, the ELISA testing conditions should be optimized for each peptide due to their different solubility characteristics. For validation, researchers can generate monoclonal antibodies against the identified immunogenic regions and test their reactivity with the native viral protein.

How can researchers develop effective serological assays using recombinant M protein for rat coronavirus detection?

Developing effective serological assays using recombinant M protein requires methodical optimization:

  • Assay format selection:

    • ELISA: Standard format for high-throughput screening

    • Lateral flow: For rapid point-of-need testing

    • Multiplex bead assays: For simultaneous detection of antibodies against multiple viral proteins

  • Antigen preparation strategies:

    • Full-length recombinant M protein (challenging due to transmembrane domains)

    • Immunodominant peptide cocktails covering known epitopes

    • Chimeric constructs displaying multiple epitopes on a soluble scaffold

  • Optimization parameters:

    • Antigen coating concentration (typically 1-10 μg/ml)

    • Blocking agents (BSA, casein, commercial blockers)

    • Sample dilution series (typically 1:100 to 1:3200)

    • Secondary antibody selection and dilution

    • Substrate selection for optimal signal-to-noise ratio

  • Validation requirements:

    • Sensitivity and specificity testing using confirmed positive and negative samples

    • Cross-reactivity assessment with other coronavirus strains

    • Reproducibility evaluation (intra- and inter-assay)

    • Stability testing under various storage conditions

Based on experimental data, researchers should focus particularly on including peptides from the highly antigenic regions identified in the M protein (N-terminal exterior region and C-terminal segments) while avoiding the hydrophobic transmembrane domains that show poor immunoreactivity . For optimal performance, consider using a combination of recombinant protein domains and synthetic peptides representing the most immunogenic epitopes.

What techniques can differentiate immune responses to different rat coronavirus strains based on M protein variations?

Differentiating immune responses to various rat coronavirus strains based on M protein variations requires sophisticated analytical approaches:

  • Epitope-specific antibody detection:

    • Design strain-specific peptides focusing on variable regions of the M protein

    • Develop competitive ELISA assays that can distinguish binding to different epitope variants

    • Use alanine scanning mutagenesis to pinpoint critical residues for antibody binding

  • Antibody affinity and avidity measurements:

    • Surface plasmon resonance (SPR) comparing binding kinetics to different M protein variants

    • Chaotropic agent-based avidity assays (using urea or ammonium thiocyanate)

    • Epitope binning using a panel of monoclonal antibodies

  • Neutralization fingerprinting:

    • Generate pseudotyped viruses displaying different M protein variants

    • Perform neutralization assays with sera from animals infected with different strains

    • Create neutralization fingerprints characteristic of each strain

  • Advanced analytical techniques:

    • Phage display with next-generation sequencing to profile antibody repertoires

    • Hydrogen-deuterium exchange mass spectrometry to map epitope-paratope interactions

    • Single B cell sorting and antibody sequencing to characterize strain-specific responses

Particular attention should be paid to the four substitution sites identified in coronavirus M proteins (codons 11, 27, 68, and 154), as these can lead to significant changes in physical and chemical properties affecting antigenicity . The substitution at codon 11 (Glu/Lys) is especially relevant as it changes pI and charge characteristics directly impacting antibody recognition .

How can researchers address challenges in expressing the full-length M protein with correct membrane topology?

Expressing full-length M protein with correct membrane topology presents several challenges that can be addressed through these methodological approaches:

  • Cell-free expression systems:

    • Use membrane-mimetic environments (nanodiscs, liposomes)

    • Add microsomal membranes for co-translational insertion

    • Optimize redox conditions to facilitate proper disulfide bond formation

  • Split-protein complementation strategies:

    • Express separate domains and reconstitute the functional protein

    • Use inteins for protein trans-splicing to join separately expressed fragments

    • Verify topology of reassembled protein using epitope tag accessibility

  • Specialized membrane protein expression vectors:

    • Include strong but inducible promoters (T7, CMV with tetracycline regulation)

    • Incorporate signal sequences optimized for membrane insertion

    • Add stabilizing fusion partners that don't interfere with membrane topology

  • Validation approaches:

    • Generate topology reporter fusions (GFP, alkaline phosphatase)

    • Use protease protection assays to confirm orientation

    • Employ antibodies against predicted exterior and interior domains

Researchers should be particularly attentive to the predicted signal peptide structure and the cleavage site (AYS-NR, between codons 39 and 40) which may be found within the first inter-TM segment . The question of whether this signal peptide is actually cleaved and released is crucial for establishing correct topology and can be experimentally verified using N-terminal sequencing of the mature protein or mass spectrometry approaches.

What are the most effective strategies for studying interactions between the M protein and host cell components?

Studying interactions between coronavirus M protein and host cell components requires specialized approaches due to the membrane-bound nature of the protein:

  • Proximity-based identification methods:

    • BioID: Fuse a promiscuous biotin ligase (BirA*) to M protein

    • APEX2: Use an engineered peroxidase to biotinylate proximal proteins

    • Identify interaction partners by streptavidin pulldown followed by mass spectrometry

  • Membrane yeast two-hybrid systems:

    • MYTH (Membrane Yeast Two-Hybrid)

    • Split-ubiquitin based interaction screening

    • Screening against cDNA libraries from relevant tissues (respiratory epithelium)

  • Co-localization studies in relevant cell types:

    • Confocal microscopy with fluorescently tagged proteins

    • Live-cell imaging to track dynamic interactions

    • Super-resolution microscopy for detailed spatial analysis

  • Functional validation approaches:

    • siRNA/CRISPR knockdown of candidate host factors

    • Competitive peptide inhibition studies

    • Domain mapping through truncation and mutation studies

Based on available data, researchers should focus particular attention on the conserved motif PETNILLNVP, which shows significant similarity (96% identity) to a segment in Vomeronasal 1 receptor involved in membrane trafficking and signal transduction . This motif might play a crucial role in interactions with host factors in respiratory epithelial cells, potentially linking to respiratory manifestations of coronavirus infections.

How can researchers investigate functional differences between natural and recombinant M protein variants?

Investigating functional differences between natural and recombinant M protein variants requires comprehensive comparative analyses:

  • Structural comparison methods:

    • CD spectroscopy to compare secondary structure profiles

    • Thermal stability assays to detect differences in protein folding

    • Limited proteolysis to identify differently accessible regions

  • Functional assays:

    • Membrane integration efficiency in model systems

    • Oligomerization behavior analysis using crosslinking or native PAGE

    • Interaction affinity measurements with other viral proteins

  • Cell-based functional experiments:

    • Virus-like particle formation efficiency

    • Cell-cell fusion promotion capabilities

    • Subcellular localization patterns in relevant cell types

  • Validation in virus systems:

    • Complementation assays using M-deleted virus constructs

    • Reverse genetics to introduce specific mutations

    • Growth curve analysis and plaque phenotype characterization

Researchers should pay particular attention to the four types of substitutions documented in coronavirus M proteins that cause non-synonymous changes . These substitutions affect:

  • pI and charge properties, influencing antigenicity

  • Hydrophobicity of the transmembrane regions, affecting membrane integration

  • Hydrophilicity of interior structures, potentially altering interactions with other viral components

By systematically introducing these substitutions into recombinant proteins and comparing their properties with natural variants, researchers can gain insights into the functional significance of these variations.

How can structural biology approaches advance our understanding of rat coronavirus M protein function?

Advanced structural biology approaches can significantly enhance our understanding of rat coronavirus M protein:

  • Cryo-electron microscopy applications:

    • Single-particle analysis of M protein in detergent micelles or nanodiscs

    • Subtomogram averaging of M protein within virus-like particles

    • In situ structural determination within viral particles

  • Integrative structural biology workflow:

    • Combine AlphaFold2/RoseTTAFold predictions with experimental constraints

    • Use crosslinking mass spectrometry (XL-MS) to obtain distance restraints

    • Incorporate EPR and FRET data to refine structural models

  • Dynamic structural studies:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

    • Solid-state NMR to analyze specific labeled regions in membrane environments

    • Molecular dynamics simulations validated with experimental data

  • High-resolution imaging:

    • Cryo-electron tomography of M protein in reconstituted membranes

    • Super-resolution fluorescence microscopy to track M protein organization

    • Atomic force microscopy to analyze topography in supported bilayers

These approaches can help elucidate the structural basis for the M protein's multiple functions, particularly focusing on the experimentally determined conserved motifs such as the segment between codons 94-114 that is implicated in interactions with the N protein and viral RNA . Understanding the structural organization of the C-terminal interior region with its phosphorylation sites for casein kinase II (TSR at codon 171, SQR at 183) would also provide insights into how post-translational modifications regulate M protein function .

What novel experimental approaches can address the potential role of M protein in rat coronavirus cross-species transmission?

Investigating M protein's role in cross-species transmission requires innovative experimental strategies:

  • Receptor binding and host range studies:

    • Generate chimeric M proteins with regions from different coronavirus species

    • Test infection efficiency in organoid models from different host species

    • Analyze the contribution of M protein to host range independently of S protein

  • Adaptation monitoring approaches:

    • Serial passage experiments in alternate host cells

    • Deep mutational scanning of M protein to identify adaptive mutations

    • Competitive fitness assays comparing different M protein variants

  • Structural adaptation analysis:

    • Comparative structural biology across host-adapted variants

    • Molecular dynamics simulations of M protein in different host membrane compositions

    • Interface analysis between M protein and host-specific factors

  • Surveillance and prediction tools:

    • Machine learning algorithms to identify high-risk variations

    • Evolutionary trace analysis to correlate sequence changes with host shifts

    • Structural modeling of recombinant forms detected in wildlife surveillance

Recent research on rat coronaviruses has identified potential recombination events involving RCoV-GCCDC4, murine hepatitis virus (MHV), and Longquan Rl rat coronavirus . The detection of such recombinant viruses with novel genomic architectures emphasizes the importance of studying how structural proteins like M contribute to cross-species transmission potential. Particularly interesting is the discovery of polybasic cleavage sites in some rodent coronaviruses, which could enhance viral entry mechanisms .

What emerging technologies can improve the production and functional analysis of difficult-to-express M protein variants?

Emerging technologies offer promising solutions for challenging M protein research:

  • Next-generation expression systems:

    • Cell-free expression platforms optimized for membrane proteins

    • Engineered strains with enhanced membrane protein folding machinery

    • Transient amplifying RNA (taRNA) systems for high-yield expression

  • Membrane mimetic advances:

    • Designer nanodiscs with tunable properties

    • Synthetic polymer-based membrane mimetics

    • 3D-printable microfluidic systems for automated reconstitution

  • High-throughput screening platforms:

    • Droplet microfluidics for expression condition optimization

    • Automated construct design and cloning systems

    • Parallelized purification and functional screening

  • Advanced analytical techniques:

    • Native mass spectrometry for membrane protein complexes

    • Microfluidic diffusional sizing for interaction analysis

    • Single-molecule fluorescence spectroscopy for conformational dynamics

These technologies can help overcome the challenges associated with the hydrophobic nature of the M protein's triple-spanning transmembrane region and its tendency to aggregate during purification. Particularly promising are approaches that can maintain the native-like membrane environment critical for proper folding and function of the M protein, while still allowing high-resolution structural and functional analyses.

By systematically applying these emerging technologies to rat coronavirus M protein research, investigators can gain deeper insights into its role in viral assembly, host-pathogen interactions, and potential contribution to cross-species transmission events.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.