Recombinant Rat Corticotropin-releasing factor receptor 2 (Crhr2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Rat Crhr2 refers to artificially synthesized versions of the corticotropin-releasing hormone receptor 2 protein, produced using expression systems like Escherichia coli or mammalian cells . Crhr2 is a class B GPCR that binds corticotropin-releasing hormone (CRH) and urocortins, playing roles in stress response, metabolic regulation, and cardiovascular homeostasis . Unlike endogenous Crhr2, recombinant forms are engineered with tags (e.g., His, GST) for purification and detection .

Table 1: Common Recombinant Rat Crhr2 Constructs

Catalog No.Host SystemTagProtein LengthApplication
ABIN6378783E. coliNoneFull-length (1–411)WB, SDS-PAGE
CRHR2-1598RMammalian CellsHisFull-lengthFunctional assays
CSB-CF005966RAE. coliNot specifiedPartial (Asp32–Val140)Binding studies

Key purification methods include affinity chromatography (via His/GST tags) and lyophilization in buffers with stabilizers like trehalose .

Research Applications

  • Cardiovascular studies: Chronic Crhr2 activation exacerbates heart failure via cAMP/EPAC signaling, while antagonists improve outcomes in pressure-overload models .

  • Metabolic regulation: Acute Crhr2 activation induces insulin resistance in skeletal muscle, whereas chronic exposure desensitizes receptors and restores glucose tolerance .

  • Stress response: Crhr2 knockout mice exhibit HPA-axis dysregulation and anxiety-like behaviors, highlighting its role in stress recovery .

Table 2: Key Pathways Involving Crhr2

PathwayAssociated Proteins/ProcessesRelevance to Crhr2
cAMP signalingGαs, adenylate cyclase, CREBMediates metabolic effects
GPCR downstream signalingβ-Arrestin, CaMKII, EPACCardiac dysfunction
Neuroactive ligand-receptor interactionUrocortins, CRH, PTHStress and hormonal regulation

Crhr2 interacts with ligands (e.g., urocortin 2), G proteins (Gs/Gi), and downstream effectors like CREB and MEF2 .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Crhr2; Crf2r; Corticotropin-releasing factor receptor 2; CRF-R-2; CRF-R2; CRFR-2; Corticotropin-releasing hormone receptor 2; CRH-R-2; CRH-R2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-411
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
LAEELLLDGWGEPPDPEGPYSYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTR NAYRECLENGTWASRINYSHCEPILDDKQRKYDLHYRIALIINYLGHCVSVVALVAAFLL FLVLRSIRCLRNVIHWNLITTFILRNITWFLLQLIDHEVHEGNEVWCRCVTTIFNYFVVT NFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIVAWAVGKLYYENEQCWFG KEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLP LLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRSALRKRWHRW QDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV
Uniprot No.

Target Background

Function
Corticotropin-releasing factor receptor 2 (CRHR2) is a G-protein coupled receptor that binds to corticotropin-releasing factor (CRF), urocortin (UCN), UCN2, and UCN3. It exhibits a high affinity for UCN. Ligand binding triggers a conformational change, initiating signaling through guanine nucleotide-binding proteins (G proteins) and downstream effectors, such as adenylate cyclase. CRHR2 promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels.
Gene References Into Functions
  1. Post-sensitization, significantly higher CRF1 and CRF2 receptor levels were observed in the Hippocampus. Moreover, CRF2 receptor levels were augmented by sensitization in the PreFrontal Cortex, and treatment and time-induced increases were detected in the Dorsal Striatum. PMID: 29857328
  2. CRF2 signaling has the potential to modulate intestinal epithelial cell differentiation, which could be relevant to stress-induced epithelial alterations observed in inflammatory bowel diseases. PMID: 28811708
  3. Our findings suggest that the CRF-induced analgesic effect may be partially mediated by CRF-R2 receptors located in the periaquaductal gray matter. PMID: 27779480
  4. CRFR2 levels were elevated 3-7 days following the auditory stimulus in rats. PMID: 27538655
  5. Water avoidance stress induced visceral hyposensitivity through peripheral CRF receptor type 2 and central dopamine D2 receptor, but not through opioid pathways. PMID: 26662216
  6. UCN2 can modulate electrical remodeling of the myocardium and hemodynamics in an experimental model of spontaneous hypertensive rat via inhibition of the L-type calcium channel and CRFR2 in cardiomyocytes. PMID: 25712670
  7. In the hippocampus and hypothalamus, CRH-R2 mRNAs did not change despite acute or chronic noise stress in this study. PMID: 26333123
  8. Rats undergoing withdrawal exhibited increased anxiety-like behavior, which was reduced by ventricular infusion of the CRF2 antagonist antisauvagine-30 (ASV 2 mug/2 mul). PMID: 25205625
  9. Peripheral CRF2 activation induces colonic hyperemia through nitric oxide synthesis, without involving prostaglandin synthesis or sensory nerve activation. PMID: 25701320
  10. Estrogens act on ERalpha to upregulate CRHR2 expression in cardiomyocytes. PMID: 24035863
  11. Estrogens maintain CRHR2 expression in the myocardium, potentially through an epigenetic mechanism, and enhance UCN-induced cardioprotective effects against I/R injury. PMID: 23962778
  12. CRF(2) might have a modulatory effect on CRF(1) signaling in gastric motor activity. PMID: 23205497
  13. Npy and Crfr2 have been previously identified as candidate genes of interest associated with the chromosome 4 QTL for alcohol consumption in inbred alcohol-preferring and inbred alcohol-nonpreferring rats. PMID: 23312492
  14. The hypothalamic expression of CRF)-R was modulated by the feeding states in lean but not obese rats. PMID: 22227020
  15. CRHR2 activation decreases collapsin response mediator protein 3 expression in hippocampal neurons through a mechanism that is dependent on phospholipase/PKC signaling pathways. PMID: 22245585
  16. CRH-R2 mRNA expression was significantly lower in the basomedial amygdala of male PNS (prenatally stressed) rats compared with controls, but greater in female PNS rats, with no change in the basolateral amygdala or medial amygdala in either sex. PMID: 21854167
  17. These data support a model where an excess in CRF(1) receptor activation, combined with reduced CRF(2) receptor signaling, might contribute to a stronger expression of anxiety-like responses. PMID: 21376756
  18. Knockdown of corticotropin-releasing factor 2 by RNA interference during colitis significantly decreased the macroscopic lateral spread of ulceration. PMID: 21330446
  19. The pseudo signal peptide of the corticotropin-releasing factor receptor type 2a decreases receptor expression and prevents Gi-mediated inhibition of adenylyl cyclase activity. PMID: 20682782
  20. Type 2 CRF receptors in the VMH mediate some of the central effects of Ucn 3, and the arcuate nucleus melanocortin system may be a downstream target of VMH CRFR2 neurons. PMID: 19952342
  21. These results indicated that endogenous CRF and/or related ligands that were released in the MRN could activate the CRF(2) receptor and stimulate serotonin release in the ventral hippocampus, thereby inducing fear memory retrieval. PMID: 20072117
  22. Urocortin 1 prevents indomethacin-induced small intestinal lesions, and this action is mediated by the activation of CRFR2 and is functionally associated with the suppression of the intestinal hypermotility response caused by indomethacin. PMID: 19707872
  23. Despite adult-like effects of leptin on POMC, neuropeptide Y, and corticotropin releasing factor receptor-2 expression in neonates, leptin does not regulate food intake during early development. PMID: 12446596
  24. CRF receptor 2 in the anterior pituitary might be involved in the regulation of gonadal functions under stress. PMID: 12639937
  25. In mediating the ACTH response to shocks, alcohol, and LPS, the influence of the CRF(2) receptor remains subtle. PMID: 12746300
  26. Localization in cerebellar afferents implies pre-synaptic control of the release of CRF-like ligands, impacting on sensory information being transmitted from afferents. Membrane bound at the synapse, it plays a role in modulating afferent inputs. PMID: 12911751
  27. A novel activity of the CRF2R was described for the first time: modulation of skeletal muscle mass. PMID: 12959937
  28. At midlevels, CRF-R2 mRNA is expressed exclusively in serotonin neurons of the dorsal raphe, whereas at caudal levels approximately half the CRF-R2 mRNA is expressed in GABAergic neurons. PMID: 15174080
  29. No expression of CRF2 receptor transcripts was observed in the paraventricular nucleus, either in basal conditions or after TNBS-induced colitis. PMID: 15178552
  30. CRF-R2 mediates, at least in part, restraint stress-induced inhibition of LH pulses and may play a crucial role in the normal physiological response of stress-induced suppression of the hypothalamic GnRH pulse generator and hence the reproductive system. PMID: 15388651
  31. Ligand binding properties of CRFR2. PMID: 15652653
  32. The CRF2-mediated depression of excitatory transmission observed in control animals was switched to facilitation after withdrawal from chronic cocaine administration. PMID: 15659593
  33. This study demonstrated that p38 MAP kinase is involved in the downregulation of CRFR2beta mRNA levels induced by Ucn1, while anisomycin leads to upregulation of this receptor mRNA levels in A7r5 aortic smooth muscle cells. PMID: 15664670
  34. Changes in gastric motility induced by IV injection of des-acyl ghrelin were completely antagonized by ICV injection of a selective corticotropin-releasing factor (CRF) 2 receptor antagonist. PMID: 16012930
  35. Urocortin 2, or another CRF-related neuropeptide acting at CRF2 receptors, modulates physiological and behavioral responses to stress-related stimuli via actions on a specific subset of serotonergic neurons within the dorsal raphe nucleus. PMID: 16403469
  36. Distinct isoforms of the corticotropin releasing factor receptor are present in the cerebellum, supporting the concept that corticotropin releasing factor modulates activity in cerebellar circuits, ultimately controlling motor behavior. PMID: 16413121
  37. Results provide the first detailed analysis of the cellular localization of the full-length form of corticotropin releasing factor receptor 2 in the rat cerebellum during early postnatal development. PMID: 16820012
  38. Hypoglycemia and lipopolysaccharide stress-induced LH suppression involves activation of CRF(2) while restraint stress-induced inhibition of LH pulses involves both CRF(1) and CRF(2). PMID: 16867181
  39. The results implicate the VMN and PVN of the hypothalamus as sites for Ucn 3-CRF(2) control of food intake. PMID: 17019404
  40. Presence of a prominent CRF2 signaling system in the esophagus suggests a functional role in secretomotor activity and epithelial and muscle cell proliferation. PMID: 17218420
  41. Opposing role of the CRF(2) receptor subtype within the central nucleus of the amygdal in mediating ethanol self-administration withdrawal. PMID: 17512918
  42. A CRHR-2-mediated mechanism in the brain stimulates corticotropin-releasing hormone- and arginine vasopressin-producing neurons in parvocellular paraventricular nucleus, resulting in plasma adrenocorticotropic hormone secretion. PMID: 17551262
  43. These findings suggest that CRH-R2 mediates orexin A-induced LH suppression and it is possible that CRH and UcnII in the hypothalamus are involved in this pathway. PMID: 17680889
  44. Peripheral and central administration of exogenous urocortin 1 disrupts the fasted motility pattern of the small intestine in rats via the corticotrophin releasing factor receptor 2 and a cholinergic mechanism. PMID: 17944898
  45. Presynaptic CRF2 receptor-mediated inhibition does not reach behavioral significance. PMID: 18400885
  46. Amphetamine treatment increased CRF(2) receptor densities in most subregions of the dRN, and CRF(2) receptors were still elevated following 6 weeks of withdrawal. PMID: 18585412
  47. Antagonism of CRF receptor type 2 but not CRF receptor type 1 in the dorsal raphe nucleus abolished CRF-induced increases in medial prefrontal cortex serotonin. PMID: 18702701
  48. Glucocorticoid receptors and CRF-2 receptors participate in the CRF-induced analgesic effect. PMID: 19065825
  49. Purified recombinant UCN II protein specifically binds to CRF receptor 2 in rat ROS 17/2.8 and GH3 cells. PMID: 19334530
  50. The results indicate that CRF(2) receptor-positive neurons in the posterior medial amygdala are involved in the neural response to social defeat. PMID: 19358876

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in limbic regions of the brain such as the lateral septum, the entorhinal cortex, the hypothalamic ventromedial nucleus and several amygdaloid nuclei. Also detectable in lung, kidney and heart.

Q&A

What is the basic molecular structure of rat CRHR2?

Rat CRHR2 is a G protein-coupled receptor (GPCR) comprising 415 amino acids with seven putative membrane-spanning domains. It belongs to the calcitonin/vasoactive intestinal peptide/growth hormone-releasing hormone subfamily of GPCRs. The receptor contains an N-terminal extracellular domain critical for ligand binding, with the transmembrane domains and intracellular loops mediating downstream signaling cascades . The extracellular domain forms the primary ligand-binding pocket, while the intracellular components interact with G proteins and other signaling molecules to initiate cellular responses.

How do the splice variants of rat CRHR2 differ structurally and functionally?

Rat CRHR2 has multiple splice variants that differ primarily in their N-terminal domains, with significant functional implications:

Splice VariantStructural FeaturesExpression PatternFunctional Characteristics
CRHR2αComplete receptor with all transmembrane domainsPrimarily CNSFull signaling capacity through adenylate cyclase
CRHR2βDiffers in N-terminal extracellular domainPredominantly peripheral tissuesHigher association with Golgi apparatus compared to CRHR2α
sCRH-R2αLacks exon 6, causing frameshift and premature termination before transmembrane domainsMultiple brain regionsNot secreted despite predictions; subjected to proteasomal degradation

The soluble CRHR2α splice variant (sCRH-R2α) is particularly interesting as it contains a premature termination codon but escapes nonsense-mediated RNA decay, allowing efficient translation . While initially predicted to function as a secreted decoy receptor, research has shown that sCRH-R2α fails to traffic for secretion due to an ineffective signal peptide .

What techniques are most effective for quantifying CRHR2 expression in rat brain tissues?

For accurate quantification of CRHR2 variants in rat brain tissues, researchers should implement:

  • Quantitative RT-PCR using variant-specific primers:

    • For CRHR2α, design primers targeting exon 6 (absent in sCRH-R2α)

    • For sCRH-R2α, design primers complementary to the exon 5/7 boundary

    • Validate primer specificity using expression constructs for each variant

  • Northern blot analysis for tissue-specific expression patterns, which effectively reveals CRHR2 expression in rat pituitary and various brain regions .

  • In situ hybridization to localize specific mRNA variants within tissue sections, providing spatial resolution not available with homogenized tissue preparations.

When analyzing expression data, researchers should note that sCRH-R2α might be expressed at varying levels relative to CRHR2α across brain regions, suggesting tissue-specific regulated splicing control .

How does the distribution of CRHR2 variants differ across rat brain regions?

CRHR2 variants show distinctive distribution patterns across rat brain regions, with significant implications for experimental design:

sCRH-R2α mRNA has been detected in numerous rat brain regions including thalamus, hypothalamus, hippocampus, midbrain, medulla/pons, cortex, and cerebellum, as well as peripheral tissues such as esophagus and pituitary . The relative expression levels of sCRH-R2α compared to CRHR2α vary across these regions, suggesting differential regulation of alternative splicing in different neural circuits .

When designing region-specific studies, researchers should account for these expression patterns and consider how they might influence experimental outcomes, particularly in stress-related behavioral paradigms that involve multiple brain regions.

What is the binding affinity of different ligands to recombinant rat CRHR2?

Recombinant rat CRHR2 exhibits differential binding affinities for various ligands within the CRF peptide family:

  • CRF binds to rat CRHR2 with high affinity (Kd = 3.3 ± 0.45 nM) and specificity, though its affinity for CRHR1 is higher .

  • Urocortin 1 (UCN1) binds with higher affinity than CRF to both CRHR1 and CRHR2.

  • Urocortin 2 (UCN2) and Urocortin 3 (UCN3) are highly selective for CRHR2 with minimal activity at CRHR1 .

When designing binding studies, researchers should consider these differential affinities and selectivities, particularly when investigating the functional specificity of CRHR2-mediated responses in systems where both receptor types are expressed.

What signaling pathways are activated downstream of recombinant rat CRHR2?

Recombinant rat CRHR2 activates multiple signaling cascades upon ligand binding:

  • Adenylate cyclase pathway: CRHR2 is functionally coupled to adenylate cyclase, leading to increased intracellular cAMP levels. This can be inhibited by the CRF antagonist alpha-helCRF-(9-41) .

  • ERK1/2-p42,p44 signaling: CRHR2 activation triggers phosphorylation of ERK1/2, which can be inhibited by recombinant sCRH-R2α protein in experimental systems .

  • G-protein dependent pathways: As a GPCR, CRHR2 primarily signals through Gs proteins, though coupling to other G-protein subtypes may occur in specific cellular contexts.

When investigating these pathways, researchers should implement appropriate controls and time-course experiments to capture both rapid and sustained signaling events following receptor activation.

How does heterodimerization affect CRHR2 signaling properties?

CRHR2 forms functional heteromeric complexes with other receptors, most notably with dopamine D1 receptors (D1R), which significantly impacts signaling outcomes:

  • Both CRHR2α and CRHR2β can form heteromeric protein complexes with D1R based on their high sequence identity .

  • These interactions can be studied using nuclear localization signal (nls) tagging strategies, where adding an nls to D1R (D1Rnls) can translocate both receptors to the nucleus .

  • Heterodimerization leads to alterations in the signaling properties of both receptors, potentially creating signaling profiles distinct from those of either receptor alone.

This receptor cross-talk has important implications for understanding how stress and dopamine systems interact in stress-related behaviors and neuropsychiatric conditions .

What expression systems are optimal for producing functional recombinant rat CRHR2?

The choice of expression system significantly impacts the yield and functionality of recombinant rat CRHR2:

  • Mammalian cell systems (HEK293, COS cells):

    • Provide proper post-translational modifications and protein folding

    • Enable functional studies of membrane-embedded receptor

    • COS cells have been successfully used to express rat/human CRHR2 with preserved binding and signaling capabilities

  • Insect cell systems (Sf9, High Five):

    • Higher protein yields than mammalian cells

    • Maintain most post-translational modifications

    • Useful for structural studies requiring larger protein quantities

  • Cell-free systems:

    • Rapid production but limited post-translational modifications

    • Useful for initial binding studies but may not recapitulate all functional aspects

For functional studies, mammalian expression systems are generally preferred as they most closely recapitulate the native environment of the receptor .

What strategies can overcome common challenges in rat CRHR2 trafficking and surface expression?

Researchers often encounter challenges with CRHR2 trafficking and surface expression that can be addressed through several strategies:

  • Signal peptide optimization: The ineffective signal peptide of sCRH-R2α prevents proper trafficking; researchers can optimize signal sequences to enhance surface expression .

  • Chaperone co-expression: Co-expressing molecular chaperones can improve folding and trafficking of recombinant CRHR2.

  • Temperature manipulation: Lower incubation temperatures (30-32°C) can enhance surface expression of challenging GPCRs by slowing protein synthesis and improving folding.

  • Pharmacological chaperones: Small molecule ligands that stabilize CRHR2 conformation can increase surface expression.

  • Fusion tags: N-terminal tags like SNAP or CLIP can both facilitate detection and sometimes improve trafficking.

When implementing these strategies, researchers should verify that modifications don't alter the receptor's pharmacological properties through appropriate binding and signaling assays .

How can researchers effectively purify recombinant rat CRHR2 while maintaining functionality?

Purification of functional CRHR2 requires careful consideration of detergent selection and buffer conditions:

  • Detergent screening: Test multiple detergents (DDM, LMNG, GDN) for effective solubilization while preserving function.

  • Lipid supplementation: Including specific lipids during purification can stabilize receptor structure.

  • Ligand addition: Performing purification in the presence of high-affinity ligands can stabilize active conformations.

  • Affinity chromatography: Using carefully positioned tags (C-terminal preferred) to minimize interference with ligand binding.

  • Size exclusion chromatography: Critical for removing aggregates and ensuring homogeneous receptor preparation.

Throughout the purification process, functionality should be monitored using ligand binding assays to ensure that purified CRHR2 maintains its native binding properties .

How does rat CRHR2 contribute to stress-related pathologies in experimental models?

CRHR2 plays complex roles in stress-related pathologies with important experimental considerations:

  • CRHR2 participates in coordinating endocrine, autonomic, and behavioral responses to stress and immune challenges as a key component of the hypothalamic-pituitary-adrenocortical axis .

  • In experimental models, CRHR2 activation generally promotes stress coping and recovery, in contrast to the anxiety-promoting effects often associated with CRHR1 activation.

  • The timing of CRHR2 activation appears critical, with different outcomes observed depending on when receptor activation occurs relative to the stressor.

  • Genetic variation in CRHR2 has been associated with altered stress responses and may influence treatment outcomes in stress-related disorders.

When designing experiments to investigate CRHR2 in stress models, researchers should carefully consider the temporal aspects of receptor activation and the potential for compensatory changes in other stress-response systems .

What role does CRHR2 play in respiratory function and asthma models?

CRHR2 has significant effects on respiratory function with therapeutic implications:

  • CRHR2 participates in smooth muscle relaxation responses and may influence acute airway bronchodilator response to short-acting β2 agonist treatments in asthma .

  • Genetic variants of CRHR2 have been investigated for associations with bronchodilator responses to albuterol in asthma patients .

  • In experimental asthma models, CRHR2 activation generally promotes bronchodilation, contrasting with the bronchoconstriction sometimes associated with CRHR1 signaling.

When designing respiratory studies, researchers should consider potential interactions between CRHR2 and adrenergic signaling pathways, as these systems may have synergistic effects on airway function .

How can the confounding effects of CRHR1 activation be controlled in CRHR2-focused experiments?

Isolating CRHR2-specific effects presents challenges due to overlapping ligand specificity with CRHR1:

  • Use selective ligands: UCN2 and UCN3 are highly selective for CRHR2 over CRHR1 and should be preferred in CRHR2-specific studies .

  • Employ selective antagonists: Antisauvagine-30 and other CRHR2-selective antagonists can help confirm receptor specificity.

  • Utilize genetic approaches: CRHR1 knockout models or CRHR1-specific siRNA can eliminate CRHR1 contributions.

  • Consider regional administration: Target brain regions with high CRHR2 but minimal CRHR1 expression.

  • Implement appropriate controls: Include CRHR1-selective ligands (e.g., cortagine) as comparison conditions.

These approaches help distinguish CRHR2-specific effects from those mediated by CRHR1 or by combined receptor activation, which is crucial for interpreting experimental outcomes correctly .

How can researchers accurately distinguish between the functions of different CRHR2 splice variants?

Differentiating the functional roles of CRHR2 splice variants requires sophisticated approaches:

  • Variant-specific genetic manipulation:

    • Design splice-blocking morpholinos or CRISPR-Cas9 strategies targeting specific exon junctions

    • Generate transgenic models with variant-specific modifications

    • Use exon-specific siRNA approaches where possible

  • Rescue experiments:

    • In knockout models, selectively express individual variants to identify specific functions

    • Compare phenotypic rescue efficiency between variants

  • Computational modeling:

    • Use structural predictions to identify variant-specific binding sites for selective targeting

    • Model differential signaling based on known structural differences

When interpreting results, researchers should consider that some CRHR2 functions may depend on specific ratios of splice variants rather than individual variant activities .

What methods effectively assess the impact of nonsense-mediated decay evasion by sCRH-R2α?

The sCRH-R2α transcript contains a premature termination codon yet escapes nonsense-mediated decay (NMD), requiring specialized methods to study this phenomenon:

  • Cycloheximide experiments: Inhibit NMD with cycloheximide and compare mRNA levels before and after treatment to quantify NMD evasion .

  • Polysome profiling: Analyze association with polysomes to determine translation efficiency despite premature termination codons .

  • RNA stability assays: Measure half-life of sCRH-R2α mRNA compared to NMD-sensitive transcripts.

  • Molecular dissection:

    • Identify sequence elements that enable NMD evasion

    • Create reporter constructs with these elements to confirm functionality

  • CRISPR-mediated manipulation of NMD factors: Evaluate how altering NMD machinery affects sCRH-R2α levels.

These approaches can help elucidate the mechanisms by which sCRH-R2α escapes degradation despite containing features that typically trigger NMD .

How can heteromeric interactions between CRHR2 and other receptors be quantitatively assessed?

Quantifying CRHR2 heteromeric interactions requires sophisticated biophysical and imaging approaches:

  • Resonance energy transfer techniques:

    • Förster Resonance Energy Transfer (FRET) between appropriately tagged receptors

    • Bioluminescence Resonance Energy Transfer (BRET) for live cell measurements

    • Time-resolved FRET for improved signal-to-noise ratio

  • Protein complementation assays:

    • Split luciferase complementation

    • Split YFP or GFP approaches

  • Single-molecule imaging:

    • Super-resolution microscopy to visualize individual receptor complexes

    • Single-particle tracking to monitor dynamics of heteromeric complexes

  • Proximity ligation assays: Detect native receptor interactions without overexpression

  • Co-immunoprecipitation combined with quantitative mass spectrometry: Identify and quantify interaction partners

These methods can reveal not only the presence of heteromeric complexes but also their stoichiometry, stability, and regulation under different conditions .

What strategies can address poor expression of recombinant rat CRHR2 in experimental systems?

Researchers facing challenges with recombinant rat CRHR2 expression can implement several optimization strategies:

  • Codon optimization: Adapt the coding sequence to the preferred codon usage of the expression host while maintaining the amino acid sequence.

  • Regulatory element optimization:

    • Test different promoters to identify optimal expression levels

    • Include appropriate enhancers and untranslated regions

    • Consider inducible expression systems for potentially toxic proteins

  • Cell line selection: Screen multiple cell lines to identify those that support high CRHR2 expression.

  • Culture condition optimization:

    • Adjust temperature (30-37°C)

    • Optimize media composition and supplements

    • Fine-tune induction timing and duration

  • Post-translational modification considerations:

    • Select expression systems capable of appropriate glycosylation

    • Consider inhibitors of specific modification pathways if they interfere with receptor function

When implementing these strategies, researchers should verify that optimizations don't alter receptor pharmacology through appropriate binding and signaling assays .

How can researchers resolve conflicting data regarding CRHR2 subcellular localization?

Conflicting reports about CRHR2 subcellular localization can be resolved through comprehensive methodological approaches:

  • Complementary detection techniques:

    • Combine antibody-based detection with tagged receptor constructs

    • Use multiple antibodies targeting different epitopes

    • Implement live-cell imaging alongside fixed-cell techniques

  • Comprehensive organelle markers:

    • Use well-established markers for ER (KDEL), Golgi (Giantin), and plasma membrane

    • Employ Z-stack confocal microscopy for complete cellular analysis

  • Quantitative co-localization analysis:

    • Calculate Pearson's or Mander's coefficients for objective assessment

    • Perform line-scan analysis across cellular compartments

  • Biochemical fractionation:

    • Complement imaging with subcellular fractionation

    • Western blot analysis of different cellular compartments

When evaluating localization data, researchers should consider that CRHR2β displays higher association with the Golgi apparatus than CRHR2α, while both variants show substantial ER localization .

What techniques can distinguish between direct and indirect effects of CRHR2 activation in complex systems?

Differentiating direct CRHR2-mediated effects from indirect downstream consequences requires specialized experimental designs:

  • Temporal analysis:

    • Implement precise time-course studies to identify primary responses

    • Use rapid application techniques (e.g., microfluidics, caged compounds)

  • Pathway-specific inhibitors:

    • Apply selective inhibitors at different levels of signaling cascades

    • Use orthogonal approaches to confirm pathway involvement

  • Receptor-specific manipulations:

    • Employ CRHR2 mutants with altered signaling properties

    • Utilize biased ligands that activate specific pathways

  • Cell-specific approaches:

    • Implement conditional knockout strategies

    • Use cell type-specific promoters for manipulating receptor expression

  • Ex vivo systems:

    • Acute tissue preparation to minimize compensatory changes

    • Direct application of antagonists to specific regions

These approaches help establish causality and delineate the specific contribution of CRHR2 to observed physiological or behavioral outcomes .

What are the key unresolved questions regarding the functional significance of sCRH-R2α?

Despite significant advances, several critical questions about sCRH-R2α remain unanswered:

  • Evolutionary significance: Why is this splice variant conserved across species if it doesn't function as a secreted decoy receptor as initially predicted?

  • Intracellular functions: Does sCRH-R2α serve any specific intracellular roles before its proteasomal degradation?

  • Splicing regulation: What factors control the alternative splicing that generates sCRH-R2α, and how might this regulation be manipulated experimentally?

  • Therapeutic potential: Could manipulation of sCRH-R2α levels provide a novel approach to modulating CRHR2 signaling in stress-related disorders?

  • Disease relevance: Are there pathological conditions associated with altered ratios of sCRH-R2α to full-length CRHR2α?

Future research addressing these questions will require integrated approaches combining molecular biology, structural biology, and systems-level analyses in both physiological and pathological contexts .

How might single-cell analysis techniques advance our understanding of CRHR2 function?

Single-cell technologies offer unprecedented opportunities to resolve CRHR2 biology at cellular resolution:

  • Single-cell RNA sequencing:

    • Identify cell populations expressing specific CRHR2 variants

    • Discover correlations between CRHR2 expression and cellular states

    • Map CRHR2 variant expression across brain regions at single-cell resolution

  • Single-cell proteomics:

    • Detect post-translational modifications of CRHR2 in specific cells

    • Identify cell type-specific interaction partners

  • Spatial transcriptomics:

    • Map CRHR2 variant expression while preserving spatial context

    • Identify regional microenvironments influencing CRHR2 expression

  • Functional single-cell approaches:

    • Patch-seq to correlate CRHR2 expression with electrophysiological properties

    • Single-cell CRISPR screens to identify regulators of CRHR2 expression

These techniques will help resolve conflicting findings that may result from cellular heterogeneity within bulk tissue analyses .

What potential therapeutic applications might emerge from advanced understanding of CRHR2 biology?

Sophisticated understanding of CRHR2 biology opens several therapeutic avenues:

  • Stress-related disorders:

    • Development of CRHR2-selective agonists for anxiety and depression

    • Design of biased ligands targeting beneficial CRHR2 signaling pathways

  • Respiratory conditions:

    • CRHR2-targeted therapeutics for asthma based on smooth muscle relaxation properties

    • Personalized approaches considering CRHR2 genetic variants and bronchodilator response

  • Inflammatory conditions:

    • Targeting CRHR2 to modulate immune responses

    • Developing dual-action compounds addressing both stress and inflammation

  • Metabolic disorders:

    • Exploiting CRHR2's effects on energy expenditure and glucose metabolism

    • Developing peripherally restricted CRHR2 modulators

  • Novel delivery approaches:

    • Cell type-specific targeting of CRHR2 modulators

    • Development of allosteric modulators with improved specificity

These therapeutic directions will benefit from continued advances in understanding CRHR2 structure, signaling diversity, and context-dependent functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.