Recombinant Rat CX3C chemokine receptor 1 (Cx3cr1)

Shipped with Ice Packs
In Stock

Description

Introduction to CX3CR1

CX3CR1 is a seven-transmembrane protein belonging to the family of chemokine receptors. It serves as the specific receptor for fractalkine (CX3CL1), which is the only known member of the CX3C chemokine family . CX3CR1 has been extensively studied due to its significant roles in immune function, inflammation, and as a coreceptor for certain viral infections. The receptor is also known by several synonyms including C-X3-C CKR-1, fractalkine receptor, and in rats specifically as Rbs11 .

Originally identified and characterized in human, mouse, and rat species, CX3CR1 gained attention when it was discovered to function as a coreceptor for HIV-1 and HIV-2 envelope fusion and virus infection . This initial finding sparked considerable interest in understanding the structure and function of this receptor across different species, including rats, which serve as important model organisms in biomedical research.

Evolutionary Conservation

CX3CR1 demonstrates significant evolutionary conservation across mammalian species. This conservation underscores its fundamental biological importance. The rat CX3CR1 shares substantial structural and functional similarities with its human counterpart, exhibiting approximately 91% amino acid similarity . This high degree of conservation makes rat CX3CR1 a valuable model for studying the receptor's function in contexts relevant to human health and disease.

Structure and Characteristics of Rat CX3CR1

The rat CX3CR1 is a full-length protein consisting of 354 amino acids . Its structure follows the typical pattern of G protein-coupled receptors (GPCRs) with seven transmembrane domains that span the cell membrane. The protein's structural features enable it to interact with its ligand, fractalkine (CX3CL1), and transduce signals across the cell membrane.

Protein Characteristics

Rat CX3CR1 has several distinctive features that influence its biological functions:

PropertyDescription
Molecular WeightApproximately 40 kDa (unmodified protein)
Membrane TopologySeven transmembrane domains typical of GPCRs
Ligand BindingSpecifically binds to fractalkine (CX3CL1)
Conservation91% amino acid similarity to human CX3CR1
UniProt IDP35411
Gene SynonymsCx3cr1, Rbs11

The receptor's high degree of conservation with the human ortholog makes rat CX3CR1 an excellent model for studying receptor functionality in experimental settings relevant to human health and disease.

Production of Recombinant Rat CX3CR1

Recombinant Rat CX3CR1 is typically produced using expression systems that can accurately translate the protein's sequence and provide appropriate post-translational modifications. One common approach involves expressing the protein in bacterial systems such as E. coli, although mammalian expression systems may also be used for applications requiring specific glycosylation patterns.

Expression Systems

The choice of expression system significantly impacts the properties and functionality of the recombinant protein:

  1. Bacterial Expression (E. coli): Commonly used for producing recombinant rat CX3CR1 with N-terminal His tags. This system offers high protein yields but may lack some post-translational modifications found in the native receptor .

  2. Mammalian Expression Systems: Expression in cell lines like HEK293 can provide recombinant proteins with more native-like post-translational modifications, which may be critical for certain functional studies.

Protein Tags and Purification

Recombinant rat CX3CR1 is often produced with fusion tags that facilitate purification and detection:

Tag TypePurposeImpact on Protein
His TagPurification via metal affinity chromatographyMinimal impact on structure, may affect some interactions
Fc TagEnhanced stability and detectionLarger modification, may significantly alter some properties
Avi TagSite-specific biotinylationUseful for immobilization and detection applications

The N-terminal His-tagged recombinant rat CX3CR1 is one of the most commonly available forms, expressed in E. coli and purified to greater than 90% purity as determined by SDS-PAGE .

Functional Roles of CX3CR1

The CX3CR1 receptor plays diverse roles in normal physiology and pathological conditions. Understanding these functions is essential for researchers utilizing recombinant rat CX3CR1 in their studies.

Interaction with Fractalkine (CX3CL1)

The primary natural ligand for CX3CR1 is fractalkine, also known as CX3CL1. This interaction initiates several important cellular processes:

  1. Leukocyte Migration: CX3CR1 mediates leukocyte migration and adhesion, playing a crucial role in immune cell trafficking to sites of inflammation .

  2. Cell Adhesion: Unlike most chemokines, fractalkine exists in both soluble and membrane-bound forms. The membrane-bound form serves as an adhesion molecule for cells expressing CX3CR1, particularly leukocytes .

  3. Signal Transduction: Binding of fractalkine to CX3CR1 initiates intracellular signaling cascades that regulate cellular functions including survival, proliferation, and cytokine production.

Role in Viral Infections

CX3CR1 has been identified as an important receptor in the pathogenesis of multiple viral infections:

  1. HIV Infection: CX3CR1 can serve as a coreceptor for HIV-1 and HIV-2 envelope fusion and virus infection. This interaction can be inhibited by fractalkine, suggesting potential therapeutic approaches .

  2. Respiratory Syncytial Virus (RSV): Recent research has established CX3CR1 as a receptor for RSV in cotton rats, with findings strongly suggesting it functions as a primary receptor for naturally acquired RSV infection in humans as well .

In the context of RSV infection, the virus's G protein interacts directly with CX3CR1. Studies in cotton rats have shown that mutations in the CX3CR1 binding site of the RSV G protein prevent viral growth in the lungs, and antibodies blocking this interaction can prevent infection . This finding has significant implications for potential therapeutic strategies against RSV.

Expression Profile

CX3CR1 is expressed in various tissues and cell types, which influences its biological roles:

  1. Immune Cells: Predominantly expressed on monocytes, certain lymphocyte subsets, and microglial cells in the brain.

  2. Tissue Distribution: Found in a variety of human tissues, with expression patterns that may differ somewhat between species .

Understanding the expression profile of CX3CR1 in rats is crucial for interpreting research findings and extrapolating results to human contexts.

Applications in Research

Recombinant rat CX3CR1 has numerous applications in biomedical research, spanning from basic science to translational studies.

Immunological Applications

Recombinant rat CX3CR1 is valuable for various immunological studies:

  1. Antibody Production: Generation of anti-CX3CR1 antibodies for research applications, including blocking antibodies that can be used to study receptor function in vivo.

  2. Immunoprecipitation: Isolation of CX3CR1-interacting proteins to identify novel binding partners and signaling components.

  3. Flow Cytometry: Development of detection methods for CX3CR1-expressing cells in rat tissues and cell cultures.

Viral Infection Models

Given the role of CX3CR1 in viral infections, the recombinant protein is particularly useful for:

  1. RSV Research: Investigating the interaction between RSV G protein and CX3CR1, which is critical for viral entry and infection .

  2. Development of Antiviral Strategies: Screening compounds that might block virus-receptor interactions, potentially leading to novel therapeutic approaches.

  3. Comparative Studies: Examining differences in receptor usage between different viruses or viral strains.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Cx3cr1; Rbs11; CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; Fractalkine receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MPTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSIFYSLVFTFGLVGNLLVVLALTNS RKSKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHNAMCKLTTAFFFIGFFGGIFF ITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMFTKRKDNECLGDY PEVLQEIWPVLRNSEVNILGFVLPLLIMSFCYFRIVRTLFSCKNRKKARAIRLILLVVVV FFLFWTPYNIVIFLETLKFYNFFPSCGMKRDLRWALSVTETVAFSHCCLNPFIYAFAGEK FRRYLRHLYNKCLAVLCGRPVHAGFSTESQRSRQDSILSSLTHYTSEGEGSLLL
Uniprot No.

Target Background

Function
CX3C chemokine receptor 1 (CX3CR1) is a receptor for the chemokine fractalkine (CX3CL1), expressed on various early leukocyte populations. CX3CR1-CX3CL1 signaling plays diverse roles across different tissues, including immune response modulation, inflammation, cell adhesion, and chemotaxis. Key functions include mediating cell migration, recruiting natural killer (NK) cells to inflamed tissues, regulating atherogenesis by influencing macrophage and monocyte recruitment, promoting Th2 cell survival in lung inflammation, facilitating monocyte migration to non-inflamed tissues (differentiating into macrophages and dendritic cells), negatively regulating angiogenesis (possibly via macrophage chemotaxis), and playing a crucial role in brain microglia by regulating inflammatory responses in the CNS and synapse maturation. Specifically, it restrains microglial inflammatory responses in the CNS, preventing parenchymal damage, and participates in synaptic pruning during brain development. CX3CR1 also regulates gut microbiota by controlling immunity to intestinal bacteria and fungi, through lamina propria dendritic cell expression in the small intestine. This facilitates bacterial uptake and defense against pathogenic bacteria. Furthermore, CX3CR1 initiates innate and adaptive immune responses against disseminated commensal fungi by promoting antifungal IgG antibody production. Finally, it acts as a receptor for CCL26, inducing cell chemotaxis.
Gene References Into Functions
  1. NF-κB and the CX3CL1/CX3CR1 axis are implicated in tetanic sciatic stimulation-induced pathological pain. PMID: 28612319
  2. Fractalkine-CX3CR1 signaling is involved in limbic seizure-induced hippocampal pathologies, including microglial activation, neurodegeneration, and neuroblast production. PMID: 25461978
  3. CX3CR1 activation of pancreatic stellate cells plays a role in pancreatitis, particularly in cell proliferation where CX3CL1 levels are elevated. PMID: 24681877
  4. CX3CR1 plays a significant role in the neuroinflammatory response. PMID: 23855980
  5. TMJ inflammation upregulates CX3CR1 in the trigeminal subnucleus caudalis. PMID: 23110394
  6. The microglia CX3CR1/p38 MAP kinase signaling cascade is involved in pain processing in rats with bone cancer pain. PMID: 22613229
  7. Fractalkine (FKN) and CX3CR1 modulate cardiovascular responses in the solitary nucleus via the phosphoinositide 3-kinase pathway. PMID: 22387113
  8. Fractalkine is implicated in radicular pain, with upregulation in spinal neurons and glia following nucleus pulposus implantation. PMID: 21224760
  9. CX3CR1 contributes to dendritic cell-endothelial cell interaction. PMID: 20364328
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Most abundant in adult spinal cord, brain, kidney, gut, uterus and testes.

Q&A

What is CX3CR1 and what is its primary ligand?

CX3CR1 is a G protein-coupled receptor that serves as the specific receptor for the chemokine CX3CL1 (also known as Fractalkine). Unlike other chemokine relationships, CX3CL1 is the only known ligand for CX3CR1, making this a unique one-to-one receptor-ligand interaction. CX3CL1 is distinctive among chemokines as it exists in both membrane-bound and soluble forms, with the membrane-bound form containing a chemokine domain attached to a mucin-like stalk . The CX3CR1-CX3CL1 axis plays crucial roles in cell adhesion, migration, and signaling in various physiological and pathological conditions.

How does rat CX3CR1 structurally compare to human and mouse orthologs?

Rat CX3CR1 shares significant structural homology with its human and mouse counterparts. While the search results don't provide specific sequence identity percentages for the receptor itself, we can infer from the ligand data that there is substantial conservation. The CX3CL1 ligand shows approximately 83% sequence identity between rat and human/mouse variants (excluding the stalk region) . This high degree of conservation suggests similar functional domains in the receptor across species, though researchers should be aware of species-specific differences that might affect experimental outcomes when transitioning between model systems.

What is the tissue distribution pattern of CX3CR1 in rats?

In rats, CX3CR1 is predominantly expressed on microglia in the central nervous system, where it mediates neuron-microglia communication through interaction with neuronally-expressed CX3CL1 . Outside the CNS, CX3CR1 is expressed on various immune cells including monocytes, macrophages, natural killer cells, and certain T-cell subsets. The receptor is also found in kidney tissue, where it plays a role in renal macrophage survival and function during infection, as demonstrated in candidiasis models . This distribution pattern makes CX3CR1 particularly important in both neuroinflammatory conditions and peripheral immune responses.

What are the validated methods for detecting CX3CR1 expression in rat tissue samples?

Several validated methods can effectively detect CX3CR1 expression in rat tissues:

  • Immunohistochemistry/Immunofluorescence: Using specific antibodies against CX3CR1, this approach allows visualization of receptor distribution in tissue sections. As shown in the search results, immunofluorescence staining has been successfully used to detect CX3CR1 (green) alongside CX3CL1 (red) in rat hippocampus .

  • Western Blot Analysis: This technique quantifies CX3CR1 protein expression in tissue lysates. Research cited in the search results demonstrates its effective use in measuring CX3CR1 expression in hippocampal samples from different experimental groups .

  • RT-PCR/qPCR: These methods detect CX3CR1 mRNA expression levels and are particularly useful when examining transcriptional regulation.

  • Flow Cytometry: This approach is valuable for quantifying CX3CR1 expression on specific cell populations isolated from rat tissues.

For optimal results, researchers should validate antibody specificity using appropriate controls, including CX3CR1-knockout tissues when available.

How can I establish a functional assay to study CX3CR1 activation in rat cell models?

Establishing a functional assay for CX3CR1 activation requires:

  • Chemotaxis Assays: The search results describe a method using BaF3 mouse pro-B cells transfected with human CX3CR1 to measure migration in response to recombinant rat CX3CL1 . A similar approach can be adapted using rat cells expressing CX3CR1. Migration can be quantified using Resazurin or other viability markers to count cells that migrate through a membrane in response to CX3CL1 gradients.

  • Calcium Flux Assays: CX3CR1 activation triggers intracellular calcium mobilization, which can be measured using calcium-sensitive fluorescent dyes.

  • Phosphorylation Studies: Assess activation of downstream signaling molecules (ERK, AKT, etc.) via Western blotting following CX3CL1 stimulation.

  • Receptor Internalization: Monitor receptor endocytosis following ligand binding using fluorescently-labeled CX3CL1.

  • Neutralization Controls: Include anti-CX3CL1 antibodies (like AF537) to confirm specificity by neutralizing the observed effects .

The ED50 for rat CX3CL1-induced chemotaxis is typically 3-18 ng/mL , which serves as a useful reference range when designing dose-response experiments.

What approaches are effective for studying CX3CR1-CX3CL1 interactions in vivo in rat models?

Effective approaches for studying CX3CR1-CX3CL1 interactions in vivo include:

  • Genetic Models: While the search results mention CX3CR1-deficiency in mouse models, similar approaches using CRISPR/Cas9 or other gene editing technologies can be applied to rats to study receptor function through knockout or knockin strategies.

  • Neutralizing Antibodies: Administration of anti-CX3CL1 antibodies (such as AF537) can block the interaction between CX3CL1 and CX3CR1, allowing assessment of physiological outcomes in various disease models .

  • Viral Vector-Mediated Manipulation: The search results describe using lenti-pre-AMO-miR-195 to upregulate CX3CL1 and CX3CR1 expression in rat hippocampus . Similar viral approaches can be used to modulate receptor expression.

  • In Vivo Imaging: Techniques like intravital microscopy using fluorescently labeled antibodies or ligands can track CX3CR1-expressing cells and their interactions in live animals.

  • Pharmacological Interventions: CX3CR1 antagonists or mimetics can be administered to assess receptor function in disease models.

When designing in vivo experiments, researchers should carefully consider appropriate controls, dosing, timing, and delivery methods to ensure interpretable results.

How does the CX3CR1-CX3CL1 axis contribute to synaptic plasticity in the rat hippocampus?

The CX3CR1-CX3CL1 axis plays a significant role in hippocampal synaptic plasticity as evidenced by several studies:

  • Memory-Associated Plasticity: CX3CL1 is upregulated in the rat hippocampus during memory-associated synaptic plasticity, suggesting its importance in learning and memory processes .

  • Microglial Regulation: CX3CR1-expressing microglia respond to neuronal CX3CL1 signals, which modulates microglial activation states. Research indicates that selective microglial activation facilitates synaptic strength .

  • Homeostatic Regulation: The CX3CL1/CX3CR1 signaling pathway contributes to the homeostatic regulation of synaptic function, with disruptions potentially contributing to cognitive impairments.

  • Interaction with Other Chemokines: Studies have shown that CXCL12 regulates CX3CL1 homeostasis in cortical neurons, demonstrating that chemokine crosstalk influences synaptic function .

Methodologically, researchers investigating these mechanisms should employ electrophysiological techniques (such as field potential recordings or patch-clamp) alongside molecular analyses to correlate CX3CR1-CX3CL1 signaling with functional synaptic changes.

What role does CX3CR1 play in neuroinflammation and neurodegeneration in rat models?

CX3CR1 plays complex roles in neuroinflammation and neurodegeneration:

  • Microglial Phenotype Regulation: CX3CR1 signaling influences microglial activation states. Disruption of this signaling can exacerbate neuroinflammation, as shown in models of Parkinson's disease where CX3CR1-deficiency worsens α-synuclein-A53T induced neuroinflammation and neurodegeneration .

  • Neuroprotection vs. Neurotoxicity: The role of CX3CR1 can be context-dependent. In some models, intact CX3CR1 signaling is neuroprotective by restraining microglial activation, while in others, CX3CR1 may contribute to pathology.

  • Cerebral Hypoperfusion Models: In 2VO (two-vessel occlusion) rat models that mimic chronic cerebral hypoperfusion, both CX3CL1 and CX3CR1 expression are upregulated in the hippocampus, suggesting their involvement in the response to ischemic injury .

  • MicroRNA Regulation: MiR-195 has been shown to regulate CX3CR1 expression, with lenti-pre-AMO-miR-195 upregulating both CX3CL1 and CX3CR1 in rat hippocampus, providing a potential therapeutic target .

When designing experiments to investigate these relationships, researchers should carefully consider time course analyses, cell-specific markers, and multiple measures of neurodegeneration alongside CX3CR1 manipulation.

How does noradrenaline influence CX3CR1-CX3CL1 signaling in neuronal-microglial communication?

The search results indicate that noradrenaline induces CX3CL1 production and release by neurons , which has several implications for neuronal-microglial communication:

  • Noradrenergic Regulation: Noradrenaline can modulate neuron-microglia interactions by stimulating neuronal CX3CL1 release, which then binds to CX3CR1 on microglia.

  • Stress Response Integration: Since noradrenaline is a key mediator of stress responses, this mechanism may link stress to microglial activation states and neuroinflammation.

  • Methodological Approach: To study this phenomenon, researchers have used ICC (immunocytochemistry) and Western blotting techniques on rat neuronal cultures treated with noradrenaline .

For comprehensive investigation of this pathway, researchers should:

  • Use selective adrenergic receptor antagonists to identify specific receptor subtypes involved

  • Employ calcium imaging to track signaling dynamics

  • Utilize co-culture systems with neurons and microglia to observe functional outcomes of this regulation

  • Consider in vivo approaches with local noradrenaline administration or manipulation of noradrenergic neurons

What is the role of CX3CR1 in rat models of retinal degeneration?

CX3CR1 plays a significant role in retinal degeneration models through regulation of microglial activity:

  • Microglial Phagocytosis: The search results indicate that microglial phagocytosis and activation underlying photoreceptor degeneration are regulated by CX3CL1-CX3CR1 signaling in a mouse model of retinitis pigmentosa . Similar mechanisms likely operate in rat models.

  • Diabetic Retinopathy: In streptozotocin-induced diabetic rats, oxidative stress and inflammatory mediators in the retina are modulated by the CX3CR1-CX3CL1 axis, which can be targeted by therapeutic interventions such as astaxanthin .

  • Experimental Approaches: Researchers have successfully used immunohistochemistry (IHC-P) and Western blot techniques to assess CX3CR1 expression in retinal tissues .

When designing studies to investigate CX3CR1 in retinal degeneration, researchers should consider:

  • Specific labeling of microglial populations

  • Functional assays of microglial phagocytosis

  • In vivo imaging techniques to track microglial dynamics

  • Correlation of CX3CR1 expression with disease progression markers

How does CX3CR1 contribute to renal immune responses in rat infection models?

CX3CR1 plays an important role in renal immune responses during infection:

  • Macrophage Survival: The search results indicate that CX3CR1-dependent renal macrophage survival promotes Candida control and host survival . This suggests that CX3CR1 signaling supports tissue-resident macrophage function in kidney infection models.

  • Immunohistochemical Analysis: Researchers have used immunohistochemistry on kidney tissue samples from transgenic mice to assess CX3CR1 expression patterns during infection . Similar approaches can be applied to rat models.

For effective investigation of CX3CR1's role in renal immunity, researchers should:

  • Use flow cytometry to quantify and phenotype CX3CR1+ renal immune cells

  • Employ kidney-specific CX3CR1 manipulation (e.g., conditional knockouts or RNA interference)

  • Assess kidney function parameters alongside immune responses

  • Consider cross-talk between CX3CR1+ cells and other immune and stromal cell populations

What methodologies are most effective for studying the role of CX3CR1 in nociception and pain processing?

Based on the search results, several approaches have proven effective for studying CX3CR1's role in nociception:

  • Cerebrospinal Fluid-Contacting Nucleus: Research has shown that the cerebrospinal fluid-contacting nucleus mediates nociception via release of fractalkine (CX3CL1) . This suggests examining this specialized nucleus when studying CX3CR1-mediated pain pathways.

  • Neutralization Studies: Researchers have used neutralizing antibodies against CX3CL1 in rat models to block CX3CR1 activation and assess effects on pain perception .

  • Electrophysiological Recordings: Studies have employed methods like recording from spinal cord slices to assess how CX3CR1-CX3CL1 signaling modulates synaptic strength in pain pathways .

For comprehensive investigation of CX3CR1 in pain models, researchers should:

  • Combine behavioral pain assessments with molecular and cellular analyses

  • Use cell-specific genetic approaches to manipulate CX3CR1 in defined cell populations

  • Consider the role of CX3CR1 in both acute and chronic pain models

  • Examine interactions between CX3CR1 signaling and established pain modulatory systems

  • Employ pharmacological interventions with appropriate controls to confirm target specificity

How can I optimize recombinant rat CX3CL1 for functional studies of CX3CR1?

Optimizing recombinant rat CX3CL1 for functional studies requires attention to several technical factors:

  • Protein Domain Selection: The search results indicate that the chemokine domain of CX3CL1 (Gln25-Gly100) is sufficient for receptor activation . Using this defined domain rather than the full-length protein (which includes the mucin-like stalk) may provide more consistent results for soluble receptor activation studies.

  • Reconstitution Protocol: The search results recommend reconstituting lyophilized CX3CL1 at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin, or in carrier-free format depending on the application .

  • Storage Considerations: Use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein activity .

  • Effective Dosing: The ED50 for rat CX3CL1-induced chemotaxis is typically 3-18 ng/mL , which provides a reference range for experimental design.

  • Carrier Protein Considerations: For applications where the presence of BSA might interfere, carrier-free formulations are available .

When designing functional assays, researchers should include appropriate positive and negative controls, perform dose-response assessments, and validate activity in relevant cell systems expressing rat CX3CR1.

What are the most critical technical challenges in developing CX3CR1-targeted therapeutic approaches for neuroinflammatory conditions?

Developing CX3CR1-targeted therapeutics faces several critical challenges:

  • Cell-Type Specificity: Since CX3CR1 is expressed on multiple immune cell types, achieving cell-specific targeting is challenging but essential to avoid unwanted effects on beneficial CX3CR1-mediated processes.

  • Context-Dependent Functions: As shown in models of Parkinson's disease, CX3CR1 deficiency can exacerbate neuroinflammation , but in other contexts, CX3CR1 signaling might promote inflammation. This dichotomy complicates therapeutic development.

  • Blood-Brain Barrier (BBB) Penetrance: Ensuring that CX3CR1-targeting agents effectively cross the BBB remains a significant challenge for CNS applications.

  • Species Differences: While rat and human CX3CL1 share approximately 83% sequence identity , species-specific differences in CX3CR1 structure and function may complicate translation from rodent models to humans.

  • Temporal Considerations: The appropriate timing for CX3CR1 modulation may differ across disease stages, requiring precise temporal control of therapeutic intervention.

Researchers addressing these challenges should employ comprehensive pharmacokinetic/pharmacodynamic analyses, consider combination approaches that target multiple aspects of neuroinflammation, and develop biomarkers that predict therapeutic response.

How do post-translational modifications of CX3CR1 affect its function and detection in experimental systems?

While the search results don't specifically address post-translational modifications (PTMs) of CX3CR1, several considerations are important:

  • Phosphorylation: As a G protein-coupled receptor, CX3CR1 likely undergoes regulatory phosphorylation that affects signaling and internalization. Researchers should consider using phospho-specific antibodies or phosphoproteomic approaches to characterize these modifications.

  • Glycosylation: N-linked glycosylation can affect receptor trafficking and ligand binding. Enzymatic deglycosylation experiments can help assess the impact of glycosylation on CX3CR1 function.

  • Ubiquitination: This modification often regulates receptor degradation and trafficking. Analysis of ubiquitination patterns under different conditions may provide insights into receptor turnover.

  • Detection Challenges: PTMs can affect antibody binding, potentially leading to false negative results in immunodetection methods. Researchers should validate antibodies using multiple detection approaches and consider using epitope tags when studying modified forms of the receptor.

  • Functional Impact: Different PTMs may alter CX3CR1's affinity for CX3CL1, coupling to downstream signaling pathways, or interaction with regulatory proteins. Mutagenesis of potential modification sites can help determine their functional significance.

Researchers investigating CX3CR1 PTMs should employ mass spectrometry approaches for comprehensive modification mapping, develop site-specific antibodies for key modifications, and correlate modification patterns with functional outcomes in relevant physiological and pathological contexts.

Comparative Properties of Recombinant Rat CX3CL1 Formulations for CX3CR1 Studies

PropertyWith Carrier ProteinCarrier-Free
FormulationLyophilized from 0.2 μm filtered solution in Acetonitrile and TFA with BSALyophilized from 0.2 μm filtered solution in Acetonitrile and TFA
Reconstitution100 μg/mL in sterile PBS with ≥0.1% human or bovine serum albumin100 μg/mL in sterile PBS
ApplicationsCell/tissue culture, ELISA standardsApplications where BSA might interfere
Chemotactic Activity (ED50)3-18 ng/mL3-18 ng/mL
Storage RecommendationManual defrost freezer, avoid freeze-thaw cyclesManual defrost freezer, avoid freeze-thaw cycles
SourceE. coli-derived rat CX3CL1/Fractalkine (Gln25-Gly100)E. coli-derived rat CX3CL1/Fractalkine (Gln25-Gly100)

Table compiled from product specifications for recombinant rat CX3CL1 (catalog #537-FT/CF)

CX3CR1 and CX3CL1 Expression Changes in Rat Hippocampus Under Different Conditions

ConditionCX3CL1 ExpressionCX3CR1 ExpressionDetection MethodStatistical Significance
Sham vs. 2VOIncreased in 2VOIncreased in 2VOImmunofluorescence & Western blot*P < 0.05 vs sham group
Lenti-pre-AMO-miR-195 treatmentUpregulatedUpregulatedWestern blot*P < 0.05 vs sham; #P < 0.05 vs lenti-pre-AMO-miR-195
Memory-associated synaptic plasticityUpregulatedNot reportedNot specifiedNot reported

Table compiled from research findings reported in search results

CX3CR1-Related Antibodies and Their Validated Applications in Rat Studies

AntibodyTargetHost SpeciesValidated ApplicationsWorking DilutionCatalog Number
Anti-Rat CX3CL1/Fractalkine Chemokine DomainRat CX3CL1 (Gln25-Gly100)GoatIHC, ICC, Western Blot, Neutralization1.7 μg/mL (IHC); 0.3-1.2 μg/mL (Neutralization)AF537
Anti-CX3CR1Rat CX3CR1Not specifiedIHC, Western BlotNot specifiedNot provided

Table compiled from antibody information in search results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.