Recombinant Rat Cyclic nucleotide-gated olfactory channel (Cnga2)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Rat Cyclic Nucleotide-Gated Olfactory Channel (CNGA2) is a genetically engineered protein corresponding to the α-subunit of the olfactory cyclic nucleotide-gated (CNG) channel. It is expressed in heterologous systems (e.g., E. coli, yeast, or mammalian cells) to study its structure, function, and regulation. CNGA2 forms homotetrameric channels in vitro and associates with modulatory subunits (CNGA4, CNGB1b) in native olfactory sensory neurons to mediate odorant signal transduction .

Ligand Binding and Activation

Recombinant CNGA2 is activated by cGMP (higher affinity) and cAMP (lower affinity). Binding induces conformational changes opening the pore, permitting Na⁺/Ca²⁺ influx . Modulatory subunits (CNGA4, CNGB1b) enhance ligand sensitivity and regulate kinetics in heterotetrameric channels .

Regulatory Mechanisms

ModulatorMechanism of ActionSource
Ca²⁺/calmodulinBinds IQ motifs on CNGA4/CNGB1b, inhibiting channel activation
PIP3Binds N terminus (residues 61–90), reducing cAMP/cGMP sensitivity

Ion Selectivity

  • Wild-type (WT): Cation-selective (P<sub>Cl</sub>/P<sub>Na</sub> ≈ 0.07) .

  • Mutants (E342K/R): Anion-selective (P<sub>Cl</sub>/P<sub>Na</sub> ≈ 10–14), with NO₃⁻ > I⁻ > Br⁻ > Cl⁻ permeability .

Production Methods

MethodHost SystemTagsApplicationsSource
Bacterial expressionE. coliHis-tagBiochemical assays, antibody production
Mammalian expressionHEK293 cellsGST-tagElectrophysiology, structural studies

Research Applications

  1. Electrophysiology: Studying ligand-gated activation and ion permeation .

  2. Structural Biology: Cryo-EM/CRISPR to map subunit interactions and PIP3-binding sites .

  3. Antibody Development: Detecting CNGA2 expression in olfactory epithelia .

  4. Disease Modeling: Investigating channelopathies linked to olfactory dysfunction .

Role of Modulatory Subunits

  • CNGB1b: Binds cAMP/cGMP independently, accelerating channel deactivation .

  • CNGA4: Mediates Ca²⁺/calmodulin inhibition via an IQ-type motif .

PIP3 Regulation

  • Directly binds residues 61–90 in the CNGA2 N terminus, occluding Ca²⁺/calmodulin binding and reducing cGMP sensitivity .

Ion Selectivity Mutants

  • E342K/E342R: Reverses charge in the P-loop, switching selectivity from cations to anions .

Future Directions

Recombinant CNGA2 remains pivotal for:

  1. Therapeutic Targeting: Designing drugs to modulate olfactory sensitivity.

  2. Sensory Prosthetics: Engineering CNG channels for artificial olfaction systems.

  3. Structural Elucidation: Mapping interactions with odorants and regulatory molecules.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, and customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag type.
Synonyms
Cnga2; Cncg2; Cyclic nucleotide-gated olfactory channel; Cyclic nucleotide-gated cation channel 2; Cyclic nucleotide-gated channel alpha-2; CNG channel alpha-2; CNG-2; CNG2; Cyclic nucleotide-gated olfactory channel subunit OCNC1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-664
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MMTEKSNGVKSSPANNHNHHPPPSIKANGKDDHRAGSRPQSVAADDDTSPELQRLAEMDT PRRGRGGFQRIVRLVGVIRDWANKNFREEEPRPDSFLERFRGPELQTVTTHQGDDKGGKD GEGKGTKKKFELFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQRNYFVVWLVL DYFSDTVYIADLIIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLIYFAV GIHSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYVISK SIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFL IGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEAKVIKWFDYLWT NKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPG DYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTA NIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVAASMEVDVQ EKLEQLETNMDTLYTRFARLLAEYTGAQQKLKQRITVLETKMKQNHEDDYLSDGINTPEP TAAE
Uniprot No.

Target Background

Function
Odorant signal transduction is likely mediated by a G-protein coupled cascade utilizing cAMP as a second messenger. The olfactory channel demonstrates activation by cyclic nucleotides, leading to depolarization of olfactory sensory neurons.
Database Links
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Olfactory neurons.

Q&A

What is the native subunit composition of rat olfactory cyclic nucleotide-gated channels?

The native cyclic nucleotide-gated (CNG) channel in rat olfactory sensory neurons (OSNs) is a heterotetramer composed of three distinct subunits: CNCα3, CNCα4, and CNCβ1b. These three subunits co-assemble to form functional channels in the sensory cilia of OSNs. Single-channel analyses of native rat olfactory channels and channels expressed heterologously from various combinations of these subunits confirm that the native CNG channel requires all three subunits to reproduce the characteristic properties observed in vivo . Analysis of mRNA and protein expression patterns demonstrates that all three subunits are co-expressed and colocalized specifically in the sensory cilia of olfactory neurons .

What are the functional domains of CNGA2 and their significance?

CNGA2 contains several functional domains critical for channel operation. The protein has a calculated molecular mass of approximately 96.4 kDa and appears as glycosylated forms of 72-80 kDa on Western blots . Key functional domains include the transmembrane segments, the pore region, and a cyclic nucleotide-binding domain that mediates channel activation in response to cAMP or cGMP. Research using CRISPR-mediated deletions targeting exon 6 of cnga2a (encoding amino acids 360-561) and cnga2b (encoding amino acids 249-431) demonstrates that these regions contain domains essential for proper channel function . When designing mutations or selecting antibodies, researchers should consider these domain structures to accurately interpret functional consequences.

What are validated methods for detecting CNGA2 protein expression?

Multiple complementary approaches can reliably detect CNGA2 protein expression:

  • Western blot analysis: Using validated antibodies such as mAb L55/54, CNGA2 protein appears as two bands of approximately 72-80 kDa, likely representing different glycosylation states. When performing Western blots, include appropriate controls (e.g., empty vector-transfected cells) to identify potential cross-reactivity with other proteins .

  • Immunofluorescence staining: Immunostaining of cultured cells or tissue sections can localize CNGA2 expression. For cell culture experiments, transfect cells with CNGA2 cDNA alongside visualization markers like EGFP to confirm specificity. Standard protocols using 3% paraformaldehyde fixation and 0.5% Triton-X100 permeabilization have proven effective for CNGA2 detection .

  • Heterologous expression systems: HEK293T cells transiently transfected with CNGA2 cDNA provide an effective system for antibody validation and protein characterization before proceeding to more complex native tissues .

How can I generate and validate CNGA2 knockout models?

Several approaches have been validated for generating CNGA2 knockout models:

  • CRISPR/Cas9 gene targeting: This method has successfully generated germline-transmitted mutant lines in zebrafish. Two effective strategies include:

    • Creating nonsense mutations resulting in premature stop codons (e.g., 2 bp indel in cnga2a)

    • Using double-guided CRISPR to generate large in-frame deletions of functional domains (e.g., deletion of exon 6)

  • Validation strategies:

    • PCR genotyping using gene-specific primers (analyze products on 1% agarose gels for large deletions or 4% MetaPhor gels for small indels)

    • Western blot analysis to confirm protein reduction/absence

    • Functional assays to assess channel activity

    • Behavioral tests to evaluate sensory function

When creating CNGA2 knockout models, researchers should be aware of potential compensatory mechanisms from paralogous genes, as demonstrated by the persistence of immunoreactivity in some cnga2a mutants due to cross-reactivity or expression of related proteins .

How does CNGA2 dysfunction contribute to neurodegenerative pathology?

CNGA2 dysfunction has significant implications for neurodegenerative conditions, particularly Alzheimer's disease (AD). Olfactory nerve fibers project anatomically to the hippocampus through the entorhinal cortex, creating a direct pathway between olfactory function and memory centers .

Epidemiological studies have established that populations with olfactory dysfunction frequently exhibit hippocampus-dependent episodic memory deficits, which may represent an early hallmark of AD . CNGA2 knockout mice (CNGA2 -/Y) show significant Alzheimer's-like behavioral abnormalities and pathological changes, including:

  • Impaired spatial memory in Morris water maze tests

  • Deficits in passive avoidance learning

  • Activation of memory-related protein kinases including ERK, JNK, and other pathways implicated in neurodegeneration

These findings suggest that CNGA2 function may have important neuroprotective effects, and its disruption could contribute to the progression of neurodegenerative processes. Researchers studying neurodegeneration should consider including olfactory function assessments and CNGA2 expression analysis in their experimental designs.

What behavioral and molecular phenotypes characterize CNGA2 knockout models?

CNGA2 knockout mice display a consistent pattern of behavioral and molecular phenotypes that make them valuable models for studying both olfactory dysfunction and neurodegenerative processes:

Behavioral phenotypes:

  • Increased latency and distance to reach hidden platform in Morris water maze tests

  • Shorter latency and increased error rates in step-down passive avoidance tests

  • Deficits in hippocampus-dependent episodic memory

Molecular and cellular phenotypes:

  • Activation of memory-related protein kinases (ERK, JNK, protein kinase) in hippocampal extracts

  • Altered synaptic protein levels

  • Changes in tau phosphorylation

  • Morphological changes in synapses in the CA3 region of hippocampus (observable through Golgi staining)

When designing studies using CNGA2 knockout models, researchers should incorporate both behavioral and molecular assessments to comprehensively characterize phenotypes. The 12-month time point has been validated for observing significant behavioral and pathological changes .

How does cooperative binding of cyclic nucleotides regulate CNGA2 channel activation?

The activation of olfactory-type cyclic nucleotide-gated channels is highly cooperative, making this a critical consideration in experimental design and data interpretation. Unlike simpler binding models, CNGA2 channel gating exhibits complex allosteric regulation:

  • Cooperativity mechanisms: Current evidence suggests that while the binding sites of the four subunits were initially assumed to be equivalent, with higher ligand affinity in the open than closed states (by an allosteric factor f), the open probabilities for partially liganded channels did not match predictions from the Monod-Wyman-Changeux (MWC) model .

  • Alternative models:

    • The coupled-dimer (CD) model proposes that the two binding sites of a dimer are equivalent, and the channel opens only when both dimers are activated

    • Single-channel data supports a model where one or two ligands bind to the closed channel, and a further ligand binds to the open channel

  • Kinetic studies: Non-equilibrium conditions, where cyclic nucleotide concentration is changed in a step-like fashion (e.g., using flash photolysis of DEACM-cGMP), provide crucial insights into activation mechanisms that cannot be determined from steady-state measurements alone .

Researchers studying CNGA2 channel activation should design experiments that can distinguish between these different models of cooperativity, potentially combining steady-state and kinetic measurements.

What factors influence CNGA2 channel subunit assembly and trafficking?

The assembly and trafficking of CNGA2 channel subunits involve multiple regulatory mechanisms that researchers should consider:

  • Subunit stoichiometry: Native olfactory CNG channels form as heterotetramers of CNGA2, CNGA4, and CNGB1b subunits. While CNGA2 subunits can form functional homotetrameric channels when expressed alone, the properties of these channels differ significantly from native channels .

  • Domain-specific interactions: The co-assembly of different subunits depends on specific protein-protein interactions. Research using domain deletions (e.g., in exon 6 of cnga2a and cnga2b) demonstrates that these regions contain motifs essential for proper subunit assembly .

  • Targeting to sensory cilia: The three channel polypeptides (CNCα3, CNCα4, and CNCβ1b) are specifically colocalized in the sensory cilia of olfactory neurons. This suggests the presence of trafficking signals that direct the assembled channels to their appropriate subcellular location .

Experimental approaches to study these processes include co-immunoprecipitation, bimolecular fluorescence complementation, and subcellular fractionation techniques to assess the assembly state and localization of channel subunits.

How do CNGA2 channels from different species compare functionally?

Comparative studies of CNGA2 channels across species reveal important evolutionary conservation and divergence:

  • Paralogous genes: In zebrafish, two paralogous genes (cnga2a and cnga2b) encode CNGA2-like proteins. These paralogs show different expression patterns and potentially distinct functions, as demonstrated by the different phenotypes observed in knockout models .

  • Sequence conservation: Key functional domains show high conservation across species. For example, the CNCβ1b subunit sequence from residues 75-858 shares 87.5% amino acid identity with bovine rod CNCβ1a, highlighting the evolutionary importance of these regions .

  • Cross-species validation: When designing antibodies or other molecular tools, researchers should consider sequence differences between species. For instance, some antibodies developed against rat CNGA2 may show cross-reactivity with other proteins in zebrafish models .

Researchers studying CNGA2 should carefully consider species differences when translating findings between model systems and interpreting evolutionary conservation of channel functions.

How can CNGA2 research contribute to early detection of neurodegenerative diseases?

CNGA2 research has significant potential for improving early detection of neurodegenerative diseases, particularly Alzheimer's disease:

  • Biomarker development: The link between olfactory dysfunction and hippocampus-dependent episodic memory deficit suggests that measures of CNGA2 function or expression could serve as early biomarkers for AD risk .

  • Mechanistic insights: Understanding how CNGA2 dysfunction leads to memory impairments and pathological changes may reveal novel disease mechanisms. Research shows that CNGA2 knockout induces memory deficits with activation of several memory-related protein kinases in the hippocampus, including ERK and JNK, which are implicated in neurodegeneration .

  • Methodological approach: To explore these connections, researchers should:

    • Correlate olfactory function with cognitive performance in longitudinal studies

    • Examine CNGA2 expression in postmortem tissues from patients with neurodegenerative diseases

    • Develop non-invasive methods to assess CNGA2 function in humans

What are the most promising experimental approaches for studying CNGA2 in neural circuit function?

To understand CNGA2's role in neural circuit function, researchers should consider these advanced methodological approaches:

  • Conditional knockout models: Developing temporally and spatially controlled CNGA2 deletion can help distinguish developmental effects from acute functional roles in mature circuits .

  • Optogenetic and chemogenetic tools: Combining CNGA2 manipulation with circuit-specific activation or inhibition can reveal how olfactory inputs integrate with other sensory and cognitive systems.

  • In vivo calcium imaging: This can provide real-time visualization of neural activity in CNGA2-expressing neurons and their downstream targets during behavioral tasks.

  • Multi-omics approaches: Integrating transcriptomics, proteomics, and metabolomics analyses of CNGA2-deficient models can identify broader signaling networks affected by channel dysfunction.

These approaches will help address outstanding questions about how CNGA2 function influences broader neural circuit dynamics and behavior beyond primary olfactory processing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.