Recombinant Rat Cysteinyl leukotriene receptor 1 (Cysltr1)

Shipped with Ice Packs
In Stock

Description

Production and Availability

Recombinant Rat Cysltr1 is produced via E. coli expression systems, optimized for stability and purity. Key details include:

ParameterSpecification
SourceIn vitro E. coli expression system
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C (short-term); -80°C (long-term)
Handling NotesAvoid repeated freezing/thawing; store working aliquots at 4°C

Commercially available kits (e.g., CSB-CF006465RA from Cusabio) provide standardized quantities (e.g., 50 µg) for reproducible assays .

Functional Assays

  • Ligand Binding Studies: Used to investigate interactions with cysteinyl leukotrienes (LTC4, LTD4, LTE4) and antagonists (e.g., montelukast) .

  • ELISA and Western Blotting: Detects Cysltr1 expression in tissues or cells, aiding in pathway analysis .

Disease Modeling

  • Inflammatory Pathways: Mimics endogenous Cysltr1’s role in bronchoconstriction, eosinophil recruitment, and fibrosis, relevant to asthma and schistosomiasis .

  • Cancer Research: Explores Cysltr1’s overexpression in colorectal, prostate, and breast cancers, where it promotes proliferation and survival .

Comparative Analysis: Recombinant vs. Endogenous Cysltr1

FeatureRecombinant Rat Cysltr1Endogenous Cysltr1
SourceE. coli expression system Native rat tissues (e.g., lung, liver)
Sequence FidelityIdentical to endogenous protein Naturally occurring, post-translational modifications
ApplicationsIn vitro assays, ligand-binding studies In vivo studies, disease models

Research Implications

Recombinant Rat Cysltr1 serves as a critical tool for:

  • Therapeutic Development: Screening Cysltr1 antagonists for diseases like asthma or cancer .

  • Mechanistic Studies: Elucidating G-protein-coupled receptor (GPCR) signaling pathways in inflammation .

  • Species-Specific Insights: Comparing rat and human Cysltr1 interactions to refine cross-species models .

Challenges and Future Directions

  • Limited Direct Data: Most studies focus on human or murine Cysltr1; rat-specific research is sparse .

  • Post-Translational Modifications: Recombinant proteins may lack native modifications (e.g., glycosylation), affecting activity .

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference in the order notes section, and we will prepare the protein accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles to maintain protein integrity.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate this to us. We will prioritize the development of the specified tag type to meet your needs.
Synonyms
Cysltr1; Cyslt1; Cysteinyl leukotriene receptor 1; CysLTR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MVGAENMTASFSNNRCHDTIDEFRNQVYSTMYSMISVVGFFGNSFVLYVLIKTYHEKSAF QVYMINLAIADLLCVCTLPLRVVYYVHKGKWFFGDFLCRLTTYALYVNLYCSIFFMTAMS FFRCVAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLLSKSYQDEKNNTKCFEPPQ DKQTKKYVLVLHYVSLIFGFIIPFVTIIVCYTMIILTLLKNTMKKNLPSRRKAIGMIIVV TAAFLVSFMPYHIQRAIHLHFLHSETRSCDSVLRMQKSVVITLSLAASNCCFDPLLYFFS GGNFRRRLSTFRKHSLSSMTYIPKKKASLPEKGEEMCKE
Uniprot No.

Target Background

Function
Cysteinyl leukotriene receptor 1 (Cysltr1) is a receptor involved in mediating the constriction of microvascular smooth muscle during inflammatory responses. This constriction is triggered by cysteinyl leukotrienes and is mediated through a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Cysteinyl leukotriene receptor-1 antagonist montelukast prevents estradiol-induced nonbacterial inflammation in the rat prostate. PMID: 27909742
  2. The expression of CysLT(1) receptor increased after rotenone treatment of PC12 cells. PMID: 22499509
  3. Abolishing leukotriene receptor desensitization suppresses agonist-driven gene expression in a rat cell line PMID: 22230957
  4. Our findings indicate that cysteinyl leukotriene receptor 1 mediates acute neuronal damage and subacute/chronic astrogliosis following focal cerebral ischemia. PMID: 16650938
  5. At 0 to 3 hours after renal ischemia-reperfusion, CysLT1R expression on endothelial cells gradually intensified, reaching its peak at 3 hours after reperfusion PMID: 18790177

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cysteinyl leukotriene receptor 1 and what is its role in inflammatory diseases?

Cysteinyl leukotriene receptor 1 (Cysltr1) is a G-protein coupled receptor that serves as the primary receptor for cysteinyl leukotrienes (cysLTs), which are potent lipid mediators involved in inflammatory responses. Cysltr1 plays a crucial role in various inflammatory diseases, particularly asthma and allergic rhinitis . When activated by cysLTs, Cysltr1 mediates bronchoconstriction, increased vascular permeability, mucus secretion, and inflammatory cell recruitment .

In asthma specifically, Cysltr1 contributes to the pathophysiology through multiple mechanisms including airway smooth muscle contraction, promoting bronchial epithelial cell apoptosis, and enhancing inflammatory responses . Recent research has also implicated Cysltr1 in other inflammatory conditions such as schistosomiasis, where it contributes to fibrogranulomatous pathology in the liver .

How does Cysltr1 expression vary across different tissues?

Cysltr1 expression patterns vary significantly across tissues, with predominant expression observed in immune cells and organs of the immune system. Based on research findings, Cysltr1 shows strongest expression in:

  • Immune cells: Activated macrophages, basophils, eosinophils, myeloid dendritic cells, and mast cells

  • Lymphoid organs: Spleen and thymus show significant expression

  • Respiratory system: Lung tissues display notable expression

  • Cardiovascular system: Heart tissue shows meaningful expression

  • Other systems: Liver and gut exhibit variable expression levels

The differential expression pattern suggests tissue-specific roles for Cysltr1 in mediating inflammatory responses. Expression levels can be dynamically regulated by inflammatory stimuli, with increased expression often observed during inflammatory conditions.

What is known about the gene structure and transcript variants of Cysltr1?

The cysteinyl leukotriene receptor 1 gene consists of 5 exons that undergo variable splicing. Research has identified:

  • A single promoter region with multiple transcription start sites

  • Four different transcript variants for Cysltr1

  • The dominant variant (transcript I) contains exons 1, 4, and 5, and shows widespread expression across tissues, particularly in blood leukocytes, spleen, thymus, lung, and heart

The variable splicing patterns suggest differential regulation of Cysltr1 expression in different cellular contexts. The promoter region contains binding sites for various transcription factors, including STAT6, which mediates IL-4-dependent transcriptional regulation of Cysltr1 .

How is Cysltr1 expression regulated at the transcriptional level?

Cysltr1 expression is functionally regulated at the transcriptional level through several mechanisms:

  • Cytokine regulation: IL-4 significantly increases Cysltr1 expression through a STAT6 response element located in the proximal Cysltr1 promoter region

  • Temporal regulation: IL-4 stimulation increases Cysltr1 mRNA and surface protein expression in a time-dependent manner, as demonstrated by real-time PCR and flow cytometry analysis

  • Inflammatory conditions: Inflammatory states, such as those in asthma models, can upregulate Cysltr1 expression at both mRNA and protein levels

This transcriptional regulation is critical for understanding how Cysltr1-mediated signaling may be enhanced during inflammatory conditions, potentially contributing to disease pathogenesis.

How can researchers generate and characterize Cysltr1 knockout models?

Generation of Cysltr1 knockout models involves several methodical steps:

  • Homologous recombination approach:

    • Design targeting vectors to disrupt the Cysltr1 gene by replacing a portion with a neomycin cassette

    • Screen for successful recombination events in embryonic stem cells

    • Generate chimeric mice and breed to homozygosity

  • Verification of knockout:

    • Confirm deletion using conventional PCR with specific primers (expected band size for disruption: 333bp; wild-type: 284bp)

    • Validate absence of Cysltr1 expression using quantitative real-time PCR across multiple tissues (spleen, mesenteric lymph nodes, lung, liver, and gut)

    • Assess protein absence through western blotting

  • Strain considerations:

    • For studies focusing on inflammatory conditions like asthma, backcrossing to appropriate strain backgrounds (e.g., BALB/c for asthma models) is essential

    • Backcrossing should be carried to at least F10 generation to ensure genetic homogeneity

This methodological approach ensures the generation of reliable knockout models for investigating Cysltr1 function in various disease contexts.

What experimental designs are optimal for studying Cysltr1 function in inflammatory disease models?

For robust investigation of Cysltr1 function in inflammatory diseases, consider these experimental designs:

  • Asthma models:

    • OVA-induced rat/mouse asthma model represents a well-established approach

    • Parameters to measure include:

      • Histopathological changes (H&E staining)

      • Inflammatory cytokines (IL-17, IL-4)

      • Serum IgE levels

      • Inflammatory cell counts in bronchoalveolar lavage fluid

      • Cysltr1 expression levels (mRNA and protein)

  • Helminth infection models:

    • Schistosoma mansoni infection model for studying role in chronic inflammatory conditions

    • Infect mice with appropriate cercariae numbers (e.g., 35 for chronic schistosomiasis)

    • Assess:

      • Survival rates

      • Hepatic granulomatous inflammation

      • Collagen content and liver enzyme levels

      • IL-4 production in liver tissue

  • Combined pharmacological and genetic approaches:

    • Compare Cysltr1 antagonists (e.g., montelukast) with genetic knockout models

    • Examine combination therapies (e.g., Cysltr1 antagonist with disease-specific treatments like praziquantel for schistosomiasis)

These experimental approaches provide complementary insights into Cysltr1 function across different inflammatory contexts.

What methods are most effective for measuring Cysltr1 expression and activity?

For comprehensive assessment of Cysltr1 expression and activity, researchers should employ multiple complementary techniques:

  • Expression analysis:

    • Transcriptional level:

      • Reverse transcription-quantitative PCR (RT-qPCR) for mRNA quantification

      • RNA-seq for comprehensive transcriptomic profiling

    • Protein level:

      • Western blotting for total protein quantification

      • Flow cytometry for surface expression on specific cell populations

      • Immunohistochemistry for tissue localization

  • Functional assessments:

    • Calcium mobilization assays to measure receptor activation

    • Production of downstream mediators (e.g., MCP-1/CCL2 production in response to LTD4 and LTC4 stimulation)

    • Inhibition studies using selective antagonists (e.g., MK571) and comparing with non-selective inhibitors (e.g., BAY-u9773)

  • Signaling pathway analysis:

    • Phosphorylation of downstream effectors (e.g., Nrf2 pathway components)

    • Gene expression changes in response to receptor activation or inhibition

These methodological approaches provide a comprehensive toolkit for researchers to evaluate both the expression patterns and functional consequences of Cysltr1 in experimental settings.

How can Cysltr1 be targeted pharmacologically in research models?

Pharmacological targeting of Cysltr1 can be achieved through several approaches:

  • Specific Cysltr1 antagonists:

    • Montelukast sodium (most commonly used): A selective Cysltr1 antagonist that effectively blocks receptor signaling

    • MK571: A potent and selective Cysltr1 antagonist often used in experimental settings

    • Dosage considerations:

      • For rat models: Effective doses range from 1-10 mg/kg, with 4 mg/kg showing optimal results in some studies

  • Non-selective antagonists:

    • BAY-u9773: Acts on both Cysltr1 and Cysltr2, providing broader inhibition of cysLT signaling

    • Useful for distinguishing Cysltr1-specific effects from general cysLT signaling

  • Combination therapy approaches:

    • Combining Cysltr1 antagonists with disease-specific treatments shows synergistic effects

    • Example: Montelukast combined with praziquantel reduced hepatic inflammation and parasite egg burden in chronically infected schistosomiasis models more effectively than either treatment alone

Table 1: Comparative effects of different Cysltr1 antagonist doses in asthma models

ParameterControlAsthma ModelLow-dose MontelukastMedium-dose MontelukastHigh-dose Montelukast
Cysltr1 mRNA expressionBaselineSignificantly increasedModerately reducedSignificantly reducedSignificantly reduced
Cysltr1 protein expressionBaselineSignificantly increasedSlightly reducedSignificantly reducedModerately reduced
Inflammatory cell countsLowHighModerately reducedSignificantly reducedSignificantly reduced
IL-4 levelsLowHighModerately reducedSignificantly reducedSignificantly reduced
IL-17 levelsLowHighSlightly reducedModerately reducedSignificantly reduced
Bronchial epithelial apoptosisMinimalExtensiveModerately reducedSignificantly reducedSignificantly reduced

Data derived from experimental findings

How does the inhibition of Cysltr1 affect different inflammatory pathways?

Inhibition of Cysltr1 impacts multiple inflammatory pathways, producing diverse physiological effects:

  • Effects on cytokine production:

    • Decreases production of Th2 cytokines (IL-4)

    • Reduces IL-17 levels, which is associated with neutrophilic inflammation

    • Affects CCL2 (MCP-1) production, which regulates monocyte/macrophage recruitment

  • Effects on cellular processes:

    • Inhibits bronchial epithelial cell apoptosis in asthma models

    • Reduces inflammatory cell recruitment (eosinophils, macrophages, lymphocytes)

    • May lead to expansion of regulatory T cells (Tregs) during chronic inflammatory conditions

  • Signaling pathway modulation:

    • Activates the Nrf2 signaling pathway, which regulates antioxidant responses

    • Montelukast administration significantly increases Nrf2 protein expression, with optimal effects at 4 mg/kg dosage

  • Tissue remodeling effects:

    • Reduces collagen deposition and tissue fibrosis

    • Attenuates goblet cell hyperplasia in airway models

    • Decreases granulomatous inflammation in models of parasitic infection

These diverse effects highlight the central role of Cysltr1 in coordinating multiple aspects of the inflammatory response.

How should researchers interpret contradictory findings related to Cysltr1 signaling?

When encountering contradictory findings in Cysltr1 research, consider these analytical approaches:

  • Context-dependent effects:

    • Cysltr1 signaling effects may vary substantially depending on:

      • Disease model (asthma vs. parasitic infection vs. other inflammatory conditions)

      • Species differences (rat vs. mouse vs. human)

      • Cell type specificity of expression and downstream pathways

      • Acute vs. chronic inflammation settings

  • Methodological considerations:

    • Differences in:

      • Knockout strategies (global vs. conditional)

      • Antagonist specificity and dosing regimens

      • Readout methods for measuring inflammation

      • Genetic background of model organisms

  • Pathway redundancy and compensation:

    • Consider the role of Cysltr2 and other related receptors that may compensate when Cysltr1 is inhibited

    • Examine broader leukotriene pathway components (e.g., 5-lipoxygenase) that have shown differential effects across disease models:

      • 5-LO deficiency reduced inflammation in Paracoccidiodes brasiliensis, Trypanosoma cruzi, Mycobacterium tuberculosis, and S. mansoni infections

      • 5-LO deficiency increased susceptibility to Toxoplasma gondii infection

  • Integrative analysis approach:

    • Combine genetic models with pharmacological approaches

    • Utilize multiple readouts (histological, biochemical, molecular)

    • Consider temporal aspects of inflammation and intervention timing

This comprehensive analysis framework helps resolve apparent contradictions in Cysltr1 research findings.

What are emerging research directions for Cysltr1 beyond respiratory diseases?

While Cysltr1 is well-established in respiratory research, emerging evidence suggests broader applications:

  • Helminth immunology:

    • Recent evidence identifies Cysltr1 as a potential target for host-directed therapy to ameliorate fibrogranulomatous pathology in schistosomiasis

    • Combination therapy (Cysltr1 antagonist + anti-parasitic drugs) shows promise for reducing disease burden beyond traditional treatments

  • Regulatory T cell biology:

    • Cysltr1 inhibition may enhance regulatory T cell (Treg) expansion during chronic inflammatory conditions

    • This suggests potential applications in autoimmune and chronic inflammatory diseases

  • Cell trafficking and innate immunity:

    • Cysltr1 participates in regulating cell trafficking and innate immune responses

    • Cysltr1-mediated signaling enhances CCL2 production in IL-4-primed monocytic cells, suggesting a role in monocyte recruitment during inflammation

  • Nrf2 pathway interactions:

    • Cysltr1 blockade activates the Nrf2 signaling pathway, which has broad cytoprotective and anti-inflammatory effects

    • This connection suggests potential applications in oxidative stress-related pathologies

  • Epithelial cell survival:

    • Cysltr1 inhibition reduces epithelial cell apoptosis, which may have implications beyond respiratory epithelia

    • This protective effect could be relevant in other epithelial inflammatory conditions

These emerging research directions highlight the expanding significance of Cysltr1 beyond its traditional role in asthma and allergic disease.

What are common pitfalls in Cysltr1 research and how can they be addressed?

Researchers working with Cysltr1 should be aware of these common challenges:

  • Expression level variability:

    • Challenge: Significant variation in Cysltr1 expression across tissues and experimental conditions

    • Solution:

      • Always include appropriate tissue-specific controls

      • Standardize sample collection timing and processing

      • Measure multiple transcript variants to capture complete expression profile

  • Antagonist specificity issues:

    • Challenge: Incomplete selectivity of some Cysltr1 antagonists

    • Solution:

      • Compare effects of selective (MK571) versus non-selective (BAY-u9773) antagonists

      • Use genetic models (Cysltr1-/- mice) alongside pharmacological approaches

      • Consider dose-response relationships carefully

  • Model selection considerations:

    • Challenge: Different models show varying dependency on Cysltr1 signaling

    • Solution:

      • Select disease models with established Cysltr1 involvement

      • Consider species differences (rat vs. mouse models)

      • Validate key findings across multiple model systems

  • Technical limitations in measuring apoptosis:

    • Challenge: Single methods for apoptosis detection may be insufficient

    • Solution:

      • Employ multiple techniques (TUNEL, flow cytometry, transmission electron microscopy)

      • Consider measuring related markers like TNF-α

      • Correlate apoptosis markers with inflammatory cell numbers

  • Genetic background effects:

    • Challenge: Strain-dependent variations in Cysltr1 function

    • Solution:

      • Ensure sufficient backcrossing (minimum F10 generation) when creating knockout models

      • Include appropriate strain-matched controls

      • Consider testing key findings in multiple genetic backgrounds

Addressing these methodological challenges enhances the reliability and interpretability of Cysltr1 research findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.