Recombinant Rat Cysteinyl leukotriene receptor 2 (Cysltr2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Cysteinyl Leukotriene Receptor 2 (Cysltr2)

Recombinant Rat Cysteinyl leukotriene receptor 2 (Cysltr2) is a synthetic protein engineered to mimic the native rat Cysltr2, a G-protein-coupled receptor (GPCR) critical in mediating inflammatory and immune responses. Native Cysltr2 is encoded by the CYSLTR2 gene and binds cysteinyl leukotrienes (cys-LTs), including LTC₄, LTD₄, and LTE₄, with varying affinities (LTC₄ = LTD₄ >> LTE₄) . Recombinant versions are produced via heterologous expression systems (e.g., E. coli, yeast, mammalian cells) for structural, functional, or therapeutic studies .

Receptor Architecture

Cysltr2 adopts a canonical seven-transmembrane helical bundle structure with:

  • Extracellular loop 2 (ECL2) stabilized by a disulfide bond between Cys³.25 (C111 in rat) and Cys in ECL2 .

  • Intracellular helix 8 (H8), critical for G-protein and β-arrestin binding, which interacts with residues like Glu³¹⁰ (E310) to stabilize the inactive state .

  • Divergent Regions compared to Cysltr1, including shorter TM1 and TM7, altering extracellular ligand access .

Signaling Pathways

Cysltr2 couples to Gq/11 proteins, activating phosphatidylinositol-calcium signaling . A constitutively active mutant (Cysltr2-L129Q) exhibits biased signaling, favoring Gq/11 over β-arrestin pathways, and escapes desensitization .

Expression Systems

Recombinant Cysltr2 is produced in diverse systems:

Expression SystemTagSourceApplication
E. coliN-terminal HisNative-like foldingStructural studies, ligand binding assays
YeastN/APost-translational modificationsFunctional assays in eukaryotic environments
BaculovirusN/ANative-like foldingMembrane protein crystallization

Data adapted from Cusabio and Creative Biomart .

Key Applications

  • Structural Biology: X-ray crystallography to resolve ligand-binding pockets and receptor-ligand interactions .

  • Drug Development: Screening of dual Cysltr1/Cysltr2 antagonists for asthma and CNS disorders .

  • Immune Research: Studying Cysltr2’s role in dendritic cell-mediated Th2 responses and platelet activation .

Role in Immune Regulation

  • Negative Regulation of Cysltr1: Cysltr2 suppresses Cysltr1-dependent ERK phosphorylation and surface expression in dendritic cells, limiting allergic inflammation .

  • Platelet Activation: In mice, Cysltr2 is activated exclusively by LTC₄ (not LTD₄/LTE₄), driving platelet aggregation and thrombosis .

Cardiovascular and Inflammatory Effects

  • Endothelial Cell Activation: Cysltr2 upregulates proinflammatory genes (IL-8, CXCL2, TF) in human umbilical vein endothelial cells, synergizing with thrombin/PAR-1 signaling .

  • Oncogenic Potential: A CYSLTR2 mutant (L129Q) acts as a constitutively active oncogene, promoting biased Gq/11 signaling in uveal melanoma .

Heterodimerization and Cross-Regulation

Cysltr2 forms heteromers with Cysltr1, modulating receptor trafficking and signaling. Knockdown of Cysltr2 increases Cysltr1 surface expression and mast cell proliferation .

Quantitative Detection

The Rat CYSLTR2 CLIA Kit enables precise measurement of Cysltr2 in serum/plasma:

ParameterValue
Detection Range62.50–4000 pg/mL
Sensitivity37.50 pg/mL
Assay Time4.5 hours
Sample TypeSerum, plasma, biological fluids

Data from AssayGenie .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Cysltr2; Cyslt2; Cysteinyl leukotriene receptor 2; CysLTR2; RSBPT32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGVTGTPSYYSDKNCTIENFKRDFYPIIYLIIFVWGALGNGFSIYVFLQTYKKSTSVNVF MLNLAISDFLFISTLPFRADYNFRGSDWIFGDWACRIMSYSLYVNMYTSIYFLTVLSIVR FLATAHPFQMLHITSVRSAWILCGIIWVFIMASSGLLLKHGQEKKNNTTLCFELNLQKFK NLVILNYIALGVGFLLPFFILTICYLLIIRVLLKVEIPESGPRDAQRKALTTIVIAMIIF LLCFLPYHALRTIHLVTWDADSCMDELHKATVITLTLAAANSCFNPFLYYFAGENFKARL RAIFSKDHL
Uniprot No.

Target Background

Function
Cysteinyl leukotriene receptor 2 (CysLTR2) is a G-protein coupled receptor that mediates responses to cysteinyl leukotrienes via activation of a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. The expression patterns of CysLTR2 suggest regulatory roles in acute neuronal injury and in astrocytosis and microgliosis during later phases of injury. PMID: 21664436
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of rat CysLT2R and how does it compare to human CysLT2R?

Rat CysLT2R is a G protein-coupled receptor (GPCR) consisting of seven transmembrane domains. The human CysLT2R, which shares significant homology with rat CysLT2R, is a 346-amino acid protein with 38% amino acid identity to the CysLT1 receptor . Crystal structure analyses reveal that CysLT2R contains a central cavity with residues from all seven transmembrane domains (TMs) and extracellular loop 2 (ECL2). This binding pocket features a narrow opening (~3 Å diameter) between ECLs into the extracellular space and a larger access cleft (~5 Å across) from the lipid bilayer between TM4 and TM5 .

While specific rat CysLT2R structural data is more limited, comparative analyses suggest conservation of key binding site residues between species, particularly those involved in ligand recognition such as Y119³·³³, which forms multiple polar contacts with ligands and is conserved across CysLTRs .

What are the binding characteristics of rat CysLT2R toward its endogenous ligands?

Rat CysLT2R, like its human counterpart, responds to the cysteinyl leukotrienes LTC₄, LTD₄, and LTE₄. Unlike CysLT1R which preferentially binds LTD₄, CysLT2R responds equally to LTC₄ and LTD₄ with lower affinity for LTE₄ . The rank order of potency for competition binding to human CysLT2R has been established as LTC₄ = LTD₄ > LTE₄ .

When activated by these ligands, CysLT2R couples to elevation of intracellular calcium, initiating downstream signaling cascades . The receptor's binding pocket accommodates these cysteinyl leukotrienes through specific interactions with conserved residues such as Y119³·³³, which serves as a key anchoring point .

How is CysLT2R expression distributed in rat tissues and how does this compare to human expression patterns?

In humans, CysLT2R mRNA is detected in lung macrophages, airway smooth muscle, cardiac Purkinje cells, adrenal medulla cells, peripheral blood leukocytes, and brain . The gene has been mapped to chromosome 13q14, a region linked to atopic asthma .

In rats, CysLT2R shows a somewhat similar tissue distribution profile. It is notably expressed in brain tissues, as referenced in studies examining brain injury and central nervous system disorders . CysLT2R is also prominently expressed in vascular endothelial cells across species, which explains its significant role in vascular permeability and angiogenesis .

In tumor tissues, CysLT2R expression is significantly increased in the tumor vasculature compared to CysLT1R, as demonstrated in mouse models with Lewis lung carcinoma .

What are the established protocols for expressing recombinant rat CysLT2R in cell culture systems?

Recombinant rat CysLT2R can be expressed in various cell systems following these methodological approaches:

  • Expression System Selection: Common systems include HEK293T cells (for mammalian expression) and Xenopus oocytes (for functional studies). These systems have been successfully used for human CysLT2R expression and can be adapted for rat receptor expression .

  • Vector Construction:

    • Clone the full-length rat CysLT2R cDNA into an appropriate expression vector

    • Add epitope tags (e.g., HA, FLAG) if needed for detection

    • Consider using inducible expression systems for better control

  • Transfection Protocol:

    • For HEK293T cells: Use lipid-based transfection reagents with optimization for rat CysLT2R

    • For Xenopus oocytes: Inject cRNA transcribed from the cloned receptor

  • Expression Verification:

    • Western blotting using receptor-specific antibodies

    • Immunocytochemistry to confirm membrane localization

    • Radioligand binding assays using [³H]LTD₄ to confirm functional expression

  • Functional Validation:

    • Calcium mobilization assays to confirm receptor activation by LTC₄/LTD₄

    • IP₁ accumulation assays to measure downstream signaling

For structural studies, more advanced techniques involving thermostabilization and crystallization methods similar to those used for human CysLT2R would be required .

How can researchers effectively measure CysLT2R activation and signaling in experimental settings?

Researchers can measure rat CysLT2R activation and signaling using the following methodological approaches:

  • Calcium Mobilization Assays:

    • Load cells expressing rat CysLT2R with calcium-sensitive dyes (e.g., Fluo-4 AM)

    • Stimulate with LTC₄ or LTD₄ at various concentrations

    • Measure fluorescence changes using plate readers or confocal microscopy

    • Include positive controls (calcium ionophores) and negative controls (buffer only)

  • IP₁ Accumulation Assays:

    • This assay measures inositol monophosphate (IP₁) accumulation, which reflects PLC activation

    • Use HTRF-based IP₁ kits for high-throughput quantification

    • Create dose-response curves with CysLT2R agonists

    • This approach has been successful with CysLT2R mutants to assess functional responses

  • ROCK Activity Measurements:

    • Since CysLT2R activates the Rho/ROCK pathway, direct measurement of ROCK activity

    • Use ROCK activity assays following LTD₄ stimulation

    • In studies with human cells, LTD₄ stimulation increased ROCK activity, which was attenuated by CysLT2R antagonists

  • Phosphorylation Status of Downstream Targets:

    • Western blotting to detect phosphorylation of myosin light chain 2 (MLC-2) at ser19

    • Time-dependent phosphorylation of MLC-2 can be observed with LTD₄ stimulation

  • VE-cadherin Internalization:

    • For endothelial cell studies, measure VE-cadherin internalization via immunofluorescence

    • This assesses the impact on endothelial barrier function

What are the recommended methods for generating CysLT2R knockout or mutant models in rats?

To generate CysLT2R knockout or mutant models in rats, researchers should consider the following methodological approaches:

  • CRISPR/Cas9 Gene Editing:

    • Design sgRNAs targeting conserved exons of the rat Cysltr2 gene

    • Multiple sgRNAs can be tested for optimal editing efficiency

    • Delivery methods include microinjection into fertilized oocytes or electroporation

    • Verification of mutations using sequencing, PCR-based approaches

  • Specific Point Mutations for Disease Models:

    • For studying disease-relevant mutations:

      • M201V (equivalent to human M201⁵·³⁸V) related to atopic asthma

      • L129Q (equivalent to human L129³·⁴³Q) with oncogenic properties

    • Use homology-directed repair with CRISPR/Cas9 to introduce specific mutations

  • Validation of Knockout Models:

    • PCR genotyping to confirm gene disruption

    • Western blotting and immunohistochemistry to confirm absence of protein

    • Functional assays (calcium signaling) to confirm loss of receptor activity

    • Phenotypic characterization based on expected CysLT2R functions

  • Conditional Knockout Approaches:

    • Tissue-specific knockouts using Cre-loxP system

    • Particularly valuable for studying CysLT2R in specific tissues like endothelium or brain

    • Useful for distinguishing between developmental and acute effects

  • Validation Through Rescue Experiments:

    • Reintroduce wild-type or mutant CysLT2R to knockout rats to confirm specificity

    • Use tissue-specific promoters for targeted reexpression

When analyzing the resulting models, researchers should assess changes in tumor angiogenesis, endothelial permeability, and inflammatory responses, as these are key processes regulated by CysLT2R .

How does CysLT2R contribute to tumor angiogenesis and metastasis based on current research?

CysLT2R plays a critical role in tumor angiogenesis and metastasis through several molecular mechanisms:

  • Endothelial Permeability Regulation:

    • CysLT2R activation increases endothelial cell (EC) contraction and permeability

    • This occurs via the Rho-dependent myosin light chain 2 (MLC-2) and vascular endothelial (VE)-cadherin axis

    • Phosphorylation of MLC-2 at ser19 is increased following LTD₄ stimulation

    • This permeability effect is attenuated by CysLT2R antagonists

  • Tumor Blood Vessel Integrity:

    • CysLT2R promotes vascular hyperpermeability and reduces vessel integrity

    • In CysLT2R-null mice (Cysltr2⁻/⁻), tumor vasculature exhibits:

      • Significantly improved integrity

      • Increased pericyte coverage

      • Decreased leakage of administered dextran

  • Direct Effects on Tumor Growth and Metastasis:

    • In Lewis lung carcinoma (LLC) models:

      • Tumor volume was significantly reduced in Cysltr2⁻/⁻ mice compared to wild-type and Cysltr1⁻/⁻ mice

      • Tumor angiogenesis (measured by CD31 staining) was reduced in Cysltr2⁻/⁻ mice

      • Metastatic burden was significantly lower in Cysltr2⁻/⁻ mice

  • Molecular Pathway Alterations:

    • CysLT2R affects expression of key angiogenic factors:

      • Reduced bFGF (EC growth factor) transcripts in Cysltr2⁻/⁻ mouse lung endothelial cells

      • Augmented PDGF (responsible for pericyte recruitment) transcripts in Cysltr2⁻/⁻ mice

  • VEGF Independence:

    • Notably, CysLT2R promotes angiogenesis through mechanisms independent of VEGF

    • This makes it a potentially valuable target for tumors resistant to anti-VEGF therapies

The evidence indicates that CysLT2R is a "gateway for angiogenesis and EC dysregulation" that contributes to metastasis by enhancing vascular leakiness and permeability .

What is the evidence for CysLT2R involvement in asthma and other inflammatory conditions in rat models?

Evidence for CysLT2R involvement in asthma and other inflammatory conditions comes from several experimental findings:

  • Genetic Associations:

    • The human CysLT2R gene maps to chromosome 13q14, a region linked to atopic asthma

    • The M201⁵·³⁸V variant of CysLT2R is associated with atopic asthma

    • This mutation significantly decreases LTD₄ potency and efficacy to induce IP₁ accumulation compared to wild-type CysLT2R

  • Functional Studies in Animal Models:

    • LTC₄-induced animal asthma models suggest that CysLT2R-selective or dual antagonists may improve treatments of severe asthma cases

    • Studies suggest that CysLT2R, via its actions on the endothelium, regulates inflammatory responses in asthma models

    • Unlike CysLT1R antagonists which are established treatments but ineffective in many patients, targeting CysLT2R may provide benefits in refractory cases

  • Inflammatory Mediator Production:

    • CysLT2R activation drives proinflammatory gene expression phenotypes

    • This is similar to patterns observed with stimulation of protease-activated receptors

    • The inflammatory cascade triggered by CysLT2R contributes to airway inflammation

  • Other Inflammatory Conditions:

    • CysLT2R has been implicated in:

      • Skin fibrosis in atopic dermatitis models

      • Vascular leakage in models of pathological retinal neovascularization

      • Ischemia reperfusion injury

      • Remedial effects in ischemic conditions and acute brain injuries have been observed with selective inhibition of CysLT2R

  • Differential Response Patterns:

    • Different expression profiles, tissue distribution, and sensitivity to endogenous ligands for CysLT1R versus CysLT2R

    • Heterodimerization and cross-regulation between receptor subtypes

    • These factors contribute to distinct roles for each receptor in pathological conditions

The evidence collectively supports a complementary but distinct role for CysLT2R in inflammatory conditions compared to the better-characterized CysLT1R, with particular relevance in severe asthma cases resistant to conventional CysLT1R-targeted therapies.

How do CysLT2R disease-related mutations affect receptor function at the molecular level?

CysLT2R disease-related mutations alter receptor function through specific molecular mechanisms that affect structure-function relationships:

  • M201⁵·³⁸V Mutation (Associated with Atopic Asthma):

    • Location: M201⁵·³⁸ is located in transmembrane helix 5 (TM5)

    • Structural role: Together with M172⁴·⁵⁹, L173⁴·⁶⁰, and L198⁵·³⁵, it defines the shape of the hydrophobic part of the ligand-binding pocket

    • Functional impact:

      • Decreases LTD₄ potency and efficacy to induce IP₁ accumulation

      • Unlike substitutions to alanine or leucine (which render the receptor nonresponsive), the valine substitution retains some function

      • Affects TM5 displacement during receptor activation

      • Interacts with the benzamide core of antagonists, suggesting its role in modulating TM5 conformation and dynamics

  • L129³·⁴³Q Mutation (Oncogenic):

    • Location: L129³·⁴³ is located in transmembrane helix 3 (TM3)

    • Oncogenic properties: Identified as a uveal melanoma oncogene

    • Signaling mechanism: Acts via Gαq signaling

    • Structural implications:

      • The mutation likely alters the receptor's conformational equilibrium

      • May affect the interaction between TM3 and other transmembrane helices

      • Potentially creates a constitutively active receptor

  • Other Functionally Important Residues:

    • Y119³·³³: A key anchoring residue conserved in CysLTRs that forms multiple polar contacts with ligands

      • Y119³·³³F mutation decreases potencies for both LTD₄ and antagonists

    • K37¹·³¹ and H284⁷·³²: CysLT2R-specific residues that form salt bridges with ligands

      • Mutations to their CysLT1R counterparts (K37¹·³¹R or H284⁷·³²Q) drastically decrease potencies for LTD₄ activation and inhibition by antagonists

    • N202⁵·³⁹: Similar to M201⁵·³⁸, N202⁵·³⁹H affects ligand-dependent TM5 displacement in receptor activation

The molecular effects of these mutations provide insights into structure-function relationships in CysLT2R and explain how they contribute to disease pathogenesis through altered receptor signaling capabilities.

What are the key differences between CysLT1R-selective and dual CysLT1R/CysLT2R antagonists in experimental settings?

CysLT1R-selective and dual CysLT1R/CysLT2R antagonists exhibit important pharmacological differences with significant research implications:

PropertyCysLT1R-selective AntagonistsDual CysLT1R/CysLT2R Antagonists
ExamplesMontelukast (Singulair™), Zafirlukast (Accolate™), Pranlukast (Onon™), MK-571BAY u9773, BayCysLT₂, Compounds 11a-c
Binding CharacteristicsHigh affinity for CysLT1R, low affinity for CysLT2RComparable affinity for both receptors
Potency at CysLT2RExhibit low potency in competition for LTD₄ binding and as antagonists of CysLT2R signalingEffective inhibition of both receptor subtypes
Structural FeaturesTypically contain specific moieties that confer CysLT1R selectivityOften contain 3,4-dihydro-2H-1,4-benzoxazine scaffold (compounds 11a-c)
Clinical ApplicationsEstablished treatments for asthma and allergic rhinitisPotential broader therapeutic applications in severe asthma, cancer, and CNS disorders
Therapeutic LimitationsLimited efficacy in a large fraction of asthma patientsPotentially improved efficacy in refractory cases

In experimental settings, CysLT1R-selective antagonists like montelukast show minimal activity at CysLT2R, while dual antagonists effectively inhibit both receptor subtypes. Crystal structure studies have revealed that dual antagonists (compounds 11a-c) bind in the central cavity of CysLT2R, making key interactions with Y119³·³³ and other residues .

The potential advantages of dual antagonists include more comprehensive blockade of cysteinyl leukotriene signaling, which may be particularly valuable in conditions where CysLT2R plays a prominent role, such as severe asthma, vascular pathologies, and certain cancers .

How can researchers assess the efficacy of CysLT2R antagonists in tumor models?

Researchers can assess the efficacy of CysLT2R antagonists in tumor models using the following methodological approaches:

  • In Vivo Tumor Growth and Metastasis Models:

    • Syngeneic tumor models (e.g., Lewis lung carcinoma cells in mice)

    • Measure tumor volume over time (e.g., 3 weeks) following antagonist administration

    • Assess metastatic burden (number and size of metastases)

    • Compare results with control groups and CysLT1R antagonist treatment groups

  • Vascular Integrity Assessment:

    • Evaluate tumor vessel density through CD31 immunostaining

    • Measure vascular leakage using intravenously administered tracers (e.g., Texas Red-conjugated dextran)

    • Assess pericyte coverage of tumor vessels as a measure of vessel maturation

    • These parameters directly correlate with CysLT2R-mediated angiogenic effects

  • Molecular and Cellular Analysis:

    • Analyze expression of angiogenic factors (bFGF, PDGF) in tumor and endothelial cells

    • Evaluate Rho/ROCK pathway activation and MLC-2 phosphorylation status

    • Assess VE-cadherin internalization in endothelial cells

    • Measure infiltration of immune cells (CD45+ cells) to distinguish anti-angiogenic from immunomodulatory effects

  • Comparative Analysis Protocol:

    • Test multiple CysLT2R antagonists at various doses

    • Include both wild-type and receptor knockout animals

    • Compare with established anti-angiogenic therapies (e.g., VEGF inhibitors)

    • Evaluate combination therapies (CysLT2R antagonists plus standard treatments)

  • Experimental Timeline for Maximum Efficacy:

    • Preventive protocol: Start antagonist treatment before tumor establishment

    • Therapeutic protocol: Initiate treatment after tumors are established

    • Metronomic dosing: Regular scheduled administration throughout study

    • Results from these approaches have shown that CysLT2R antagonists can normalize vessels, reducing tumor growth and metastasis even when administered during tumor progression

The experimental data indicate that CysLT2R antagonists significantly reduce tumor volume, vessel density, dextran leakage, and metastases in wild-type mice, highlighting CysLT2R as a VEGF-independent regulator of the vasculature that promotes metastasis risk .

What structural features of antagonists determine selectivity between CysLT1R and CysLT2R?

The structural features determining antagonist selectivity between CysLT1R and CysLT2R have been elucidated through crystallography and structure-activity relationship studies:

  • Key Receptor Binding Pocket Differences:

    • CysLT2R-specific residues K37¹·³¹ and H284⁷·³² form salt bridges with the N-linked carboxypropyl moiety of antagonists

    • These residues differ in CysLT1R (R31¹·³¹ and Q284⁷·³²), creating distinct electrostatic environments

    • Mutating these residues to their CysLT1R counterparts drastically decreases antagonist potency, confirming their role in selectivity

  • Conserved Interaction Points:

    • Y119³·³³ serves as a key anchoring residue in both receptors, forming multiple polar contacts with the benzoxazine part, carboxylic group, and amide linker of dual antagonists

    • This conservation explains why some structural scaffolds can bind both receptors

  • Critical Structural Moieties in Antagonists:

    • 3,4-dihydro-2H-1,4-benzoxazine scaffold: Common in dual antagonists (compounds 11a-c)

    • Benzamide core: Interacts with TM5 residues (L198⁵·³⁵, M201⁵·³⁸, and N202⁵·³⁹)

    • N-linked carboxypropyl moiety: Important for CysLT2R binding through specific salt bridges

  • Structural Determinants of CysLT1R Selectivity:

    • CysLT1R-selective antagonists (montelukast, zafirlukast, pranlukast) exhibit low potency for CysLT2R

    • These antagonists likely exploit unique binding pocket features of CysLT1R

    • Specific interactions with residues that differ between the receptors contribute to their selectivity

  • Binding Pocket Access Points:

    • CysLT2R binding pocket has a narrow opening (~3 Å diameter) between ECLs into the extracellular space

    • It also has a larger access cleft (~5 Å across) from the lipid bilayer between TM4 and TM5

    • These dimensional constraints may influence antagonist access and binding

Understanding these structural determinants enables rational design of either dual antagonists or receptor-selective compounds, depending on the therapeutic goal. This structure-based approach is particularly valuable for developing improved therapeutics for conditions where CysLT2R plays a distinct pathophysiological role .

How does heterodimerization between CysLT1R and CysLT2R affect signaling and pharmacological responses?

Heterodimerization between CysLT1R and CysLT2R creates complex signaling interactions with significant implications for research and drug development:

  • Evidence for Heterodimerization:

    • CysLT1R and CysLT2R have been demonstrated to form heterodimers in various cell types

    • This physical interaction affects ligand binding properties and downstream signaling

    • The heterodimeric complex exhibits pharmacological properties distinct from either receptor alone

  • Altered Pharmacological Profiles:

    • Cross-regulation between receptors can modify sensitivity to agonists and antagonists

    • In heterodimeric complexes, CysLT1R-selective antagonists may show altered efficacy

    • This phenomenon may partly explain why some patients do not respond to CysLT1R-targeted therapy

  • Signaling Pathway Modifications:

    • Heterodimerization can lead to:

      • Altered G protein coupling preferences

      • Modified calcium signaling responses

      • Changes in receptor internalization and trafficking

      • Different patterns of β-arrestin recruitment

  • Tissue-Specific Effects:

    • The ratio of CysLT1R to CysLT2R varies across tissues

    • In contexts where both receptors are co-expressed, heterodimer formation may dominate

    • This creates tissue-specific pharmacological profiles that must be considered in drug development

  • Experimental Approaches to Study Heterodimers:

    • Bioluminescence/fluorescence resonance energy transfer (BRET/FRET) to detect physical interaction

    • Co-immunoprecipitation studies with differentially tagged receptors

    • Pharmacological studies using selective ligands for each receptor

    • Analysis of signaling in cells expressing both receptors versus those expressing each receptor individually

  • Research Implications:

    • Development of bivalent ligands targeting both receptors simultaneously

    • Design of experimental systems to isolate heterodimer-specific effects

    • Consideration of heterodimer formation in interpreting antagonist efficacy data

This complex relationship between CysLT1R and CysLT2R through heterodimerization may explain the different expression profiles, tissue distribution, and sensitivity to endogenous ligands, as well as the prevalence of asthma-associated polymorphisms in CysLT2R suggesting distinct roles for each receptor subtype in physiology and pathology .

What are the key considerations when interpreting contradictory data from different CysLT2R experimental models?

When interpreting contradictory data from different CysLT2R experimental models, researchers should consider the following methodological and biological factors:

  • Species-Specific Differences:

    • Rat, mouse, and human CysLT2R may exhibit subtle differences in:

      • Binding affinities for ligands

      • Signaling pathway coupling preferences

      • Tissue expression patterns

      • Post-translational modifications

    • Always consider species origin when comparing across studies

  • Experimental System Variations:

    • Cell-based versus in vivo models:

      • Recombinant systems may not recapitulate the complete signaling environment

      • Tumor models in different anatomical locations may yield different results

      • Primary cells versus established cell lines have different baseline characteristics

    • Expression levels can dramatically affect receptor pharmacology:

      • Overexpression systems may show response profiles not present at physiological levels

      • Examine receptor quantification methods across studies

  • Receptor Heterodimerization Effects:

    • Co-expression of CysLT1R affects CysLT2R signaling through heterodimerization

    • The relative expression ratio of CysLT1R:CysLT2R varies across models

    • Always check for presence/absence of both receptor subtypes when interpreting data

  • Assay-Dependent Outcomes:

    • Different readouts measure distinct aspects of receptor function:

      • Calcium mobilization assays capture immediate responses

      • IP₁ accumulation reflects sustained G protein activation

      • Functional endpoints (e.g., endothelial permeability) involve multiple pathways

    • Always compare similar endpoint measures across studies

  • Genetic Background Considerations:

    • In knockout models:

      • Method of gene deletion (global vs. conditional)

      • Compensatory mechanisms in constitutive knockouts

      • Potential off-target effects of genetic manipulation techniques

    • Background strain variations in mice/rats can influence phenotypes

  • Pharmacological Tool Limitations:

    • Selectivity profiles of antagonists vary across species

    • Concentration-dependent selectivity loss (high concentrations may affect both receptors)

    • Potential off-target effects beyond CysLTRs

    • Always check specificity controls in pharmacological studies

How do CysLT2R signaling pathways intersect with other inflammatory and oncogenic pathways in complex disease models?

CysLT2R signaling intersects with multiple inflammatory and oncogenic pathways, creating a complex network of interactions in disease models:

  • Intersection with VEGF-Independent Angiogenic Pathways:

    • CysLT2R promotes angiogenesis through mechanisms independent of VEGF

    • This explains why CysLT2R antagonists can be effective in scenarios where anti-VEGF therapies fail

    • The receptor regulates bFGF expression, an essential factor for angiogenesis

    • CysLT2R also influences PDGF expression, which is responsible for pericyte recruitment

  • Rho/ROCK Signaling Axis:

    • CysLT2R activation increases ROCK activity

    • This leads to phosphorylation of myosin light chain 2 (MLC-2) at ser19

    • The pathway directly impacts endothelial cell contraction and permeability

    • ROCK inhibitors (e.g., Y27632) block CysLT2R-induced permeability, confirming this mechanistic link

  • VE-Cadherin Regulation in Endothelial Barrier Function:

    • CysLT2R activation affects VE-cadherin localization and internalization

    • This disrupts endothelial adherens junctions

    • The pathway involves Rho-dependent mechanisms

    • This directly contributes to vascular hyperpermeability in pathological conditions

  • Gαq Signaling in Oncogenesis:

    • The oncogenic CysLT2R mutation (L129³·⁴³Q) acts via Gαq signaling

    • This creates a pathway linking inflammation to cancer development

    • Similar signaling is observed in uveal melanoma, where CysLT2R mutations are oncogenic drivers

  • Cross-talk with Inflammatory Cytokine Networks:

    • CysLT2R activation creates a proinflammatory gene expression phenotype

    • This pattern resembles that obtained with stimulation of protease-activated receptors

    • The receptor likely influences production of inflammatory mediators that further amplify pathological responses

  • Integration with Tissue Repair and Fibrosis Pathways:

    • CysLT2R has been implicated in skin fibrosis in atopic dermatitis models

    • This suggests intersection with TGF-β and other pro-fibrotic signaling pathways

    • The receptor may represent a link between inflammation and tissue remodeling

  • Complex Interactions in CNS Pathology:

    • CysLT2R plays a role in brain injury and CNS disorders

    • Selective inhibition shows remedial effects in ischemic conditions and acute brain injuries

    • This indicates cross-talk with neuroinflammatory and neurodegenerative pathways

These multifaceted interactions explain why CysLT2R is emerging as a promising drug target across diverse conditions including severe asthma, cancer, and brain injuries. Understanding these pathway intersections is essential for developing targeted therapeutic approaches and predicting potential synergies with existing treatments .

What are the most promising approaches for developing highly selective CysLT2R modulators?

Developing highly selective CysLT2R modulators represents a significant opportunity for therapeutic advancement. The most promising approaches include:

  • Structure-Guided Design Based on Crystal Structures:

    • Leverage the recently solved crystal structures of CysLT2R in complex with antagonists

    • Focus on exploiting the unique binding pocket features that differentiate CysLT2R from CysLT1R

    • Target CysLT2R-specific residues K37¹·³¹ and H284⁷·³² that form distinctive salt bridges with ligands

    • Design compounds that optimize interactions with these residues while minimizing interactions with corresponding residues in CysLT1R

  • Allosteric Modulator Development:

    • Target receptor sites distinct from the orthosteric binding pocket

    • Explore areas of the receptor with lower sequence conservation between subtypes

    • Identify negative allosteric modulators (NAMs) that selectively inhibit CysLT2R activation

    • This approach may yield modulators with improved selectivity profiles

  • Rational Modification of Existing Dual Antagonists:

    • Starting with compounds 11a-c and BAY u9773 as scaffolds

    • Introduce structural modifications that enhance CysLT2R selectivity

    • Focus on the N-linked carboxypropyl moiety which makes key CysLT2R-specific interactions

    • Use medicinal chemistry approaches to optimize selectivity while maintaining potency

  • Biased Ligand Development:

    • Design compounds that selectively engage beneficial signaling pathways

    • Target specific CysLT2R-coupled G proteins or β-arrestin recruitment

    • This approach may yield therapeutics with improved efficacy and reduced side effects

    • Particularly valuable for conditions where only certain CysLT2R signaling pathways are pathological

  • Computational Methods and Virtual Screening:

    • Employ molecular dynamics simulations to identify transient binding pockets

    • Use machine learning approaches trained on existing CysLT2R ligands

    • Virtual screening of compound libraries against the CysLT2R crystal structure

    • These methods can accelerate discovery of novel selective chemotypes

These approaches could lead to the development of highly selective CysLT2R antagonists or modulators with applications in severe asthma, cancer therapy, and CNS disorders where CysLT2R plays a significant pathophysiological role .

How might combination therapies targeting both CysLT2R and other pathways enhance therapeutic outcomes in complex diseases?

Combination therapies targeting CysLT2R alongside other pathways show significant promise for enhancing therapeutic outcomes in complex diseases:

  • CysLT2R Antagonists + Anti-VEGF Therapy in Cancer:

    • Rationale: CysLT2R promotes angiogenesis through VEGF-independent mechanisms

    • Potential synergy: Simultaneous blockade of complementary angiogenic pathways

    • Experimental evidence: CysLT2R-null mice show reduced tumor growth and angiogenesis

    • Clinical potential: May overcome resistance to anti-VEGF monotherapies

    • Implementation strategy: Sequential or concurrent administration protocols

  • CysLT2R + CysLT1R Dual Targeting in Severe Asthma:

    • Rationale: Different expression profiles and functions of receptor subtypes

    • Potential advantage: More comprehensive blockade of cysteinyl leukotriene signaling

    • Target population: Patients with severe asthma unresponsive to CysLT1R antagonists alone

    • Implementation approaches:

      • True dual antagonists (single molecules targeting both receptors)

      • Combination of selective antagonists at optimized doses

  • CysLT2R Antagonists + Rho/ROCK Pathway Inhibitors:

    • Mechanistic basis: CysLT2R regulates EC permeability via the Rho/ROCK pathway

    • Experimental support: ROCK inhibitors block CysLT2R-induced permeability

    • Potential applications: Vascular leakage conditions, edema, inflammatory disorders

    • Advantage: Lower doses of each agent may reduce side effects while maintaining efficacy

  • CysLT2R Targeting + Immunotherapy:

    • Rationale: Normalizing tumor vasculature can enhance immune cell infiltration

    • Mechanism: Improved vessel integrity allows better access for immune effector cells

    • Supporting evidence: CysLT2R-null mice show normalized vasculature with improved integrity

    • Clinical potential: Enhanced response to checkpoint inhibitors or adoptive cell therapies

    • Implementation: CysLT2R antagonist pretreatment followed by immunotherapy

  • CysLT2R + TGF-β Pathway Targeting in Fibrotic Diseases:

    • Rationale: CysLT2R involvement in skin fibrosis in atopic dermatitis models

    • Potential applications: Pulmonary fibrosis, liver fibrosis, systemic sclerosis

    • Mechanism: Simultaneous targeting of inflammatory and direct pro-fibrotic signals

    • Implementation: Chronic co-administration strategies targeting both pathways

  • CysLT2R Antagonists + Neuroprotective Agents in Brain Injury:

    • Rationale: CysLT2R inhibition shows remedial effects in ischemic conditions

    • Target indications: Stroke, traumatic brain injury, neurodegenerative diseases

    • Mechanism: Reduced vascular leakage plus direct neuroprotection

    • Implementation: Acute administration in emergency settings followed by maintenance therapy

These combination approaches represent rational strategies based on our understanding of CysLT2R biology and its intersection with other pathways. Each approach requires careful optimization of dosing, timing, and patient selection to maximize therapeutic benefit while minimizing potential adverse effects.

What are the technical challenges in developing CysLT2R-based biomarkers for personalized medicine approaches?

Developing CysLT2R-based biomarkers for personalized medicine faces several technical challenges that researchers must address:

  • Receptor Expression Analysis Challenges:

    • Issue: CysLT2R expression varies significantly across tissues and disease states

    • Technical limitations:

      • Antibody specificity issues for immunohistochemistry or flow cytometry

      • mRNA levels may not correlate with functional protein expression

      • Receptor internalization and trafficking affect detectable surface levels

    • Solutions:

      • Development of highly specific monoclonal antibodies

      • Validated PCR protocols for accurate transcript quantification

      • Multiple detection methods to confirm expression patterns

  • Single Nucleotide Variant (SNV) Detection Complexity:

    • Issue: Disease-associated mutations like M201⁵·³⁸V (atopic asthma) and L129³·⁴³Q (oncogenic) require reliable detection

    • Technical challenges:

      • Need for high-throughput, cost-effective genotyping methods

      • Low frequency of some variants necessitates sensitive detection

      • Correlation of genotype with functional phenotype is not always straightforward

    • Approaches:

      • Next-generation sequencing panels including CysLT2R

      • Digital PCR for rare variant detection

      • Functional assays to assess variant impact on receptor signaling

  • Functional Biomarker Development:

    • Issue: Measuring CysLT2R activity/inhibition in patient samples

    • Challenges:

      • Limited accessibility of target tissues

      • Ex vivo functional assays may not reflect in vivo receptor activity

      • Pathway redundancy confounds interpretation of downstream markers

    • Potential solutions:

      • Development of proxy biomarkers in accessible tissues/fluids

      • Phospho-MLC-2 or ROCK activity measurements in endothelial cells

      • Imaging methods to assess vascular integrity in patients

  • Heterodimer Quantification Difficulties:

    • Issue: CysLT1R/CysLT2R heterodimerization affects drug responses

    • Technical barriers:

      • No established methods to quantify heterodimer formation in patient samples

      • Heterodimer stability during sample processing

      • Functional significance of varying heterodimer levels

    • Innovative approaches needed:

      • Proximity ligation assays for tissue samples

      • Development of heterodimer-specific antibodies

      • Correlation studies linking heterodimer levels to drug responses

  • Patient Stratification Marker Validation:

    • Issue: Identifying which patients will benefit from CysLT2R-targeted therapies

    • Challenges:

      • Prospective clinical studies required for validation

      • Multiple potential biomarkers necessitate multivariate analysis

      • Integration with existing clinical parameters

    • Implementation path:

      • Initial retrospective analysis in clinical trial samples

      • Development of biomarker panels rather than single markers

      • Machine learning approaches to identify responder signatures

Addressing these challenges requires interdisciplinary approaches combining molecular biology, genetics, pharmacology, and clinical medicine. Success would enable more precise targeting of CysLT2R-directed therapies to appropriate patient populations, particularly in complex diseases like severe asthma, cancer, and CNS disorders where CysLT2R plays significant roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.