Recombinant Rat Cytochrome b5 type B (Cyb5b)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Cytochrome b5 Type B (Cyb5b)

Recombinant Rat Cytochrome b5 Type B (Cyb5b) is a genetically engineered protein produced via mammalian cell expression systems. It is a mitochondrial outer membrane-bound hemoprotein critical for electron transport processes, fatty acid metabolism, and redox reactions. Cyb5b serves as a cofactor for enzymes like cytochrome P450 and amidoxime reductases, facilitating lipid biosynthesis, cholesterol synthesis, and detoxification pathways .

Functional Roles in Metabolism and Redox Reactions

Cyb5b participates in multiple enzymatic pathways:

Lipid Metabolism

  • Fatty Acid Desaturation/Elongation: Collaborates with acyl-CoA desaturases to produce unsaturated fatty acids .

  • Cholesterol Biosynthesis: Supports cytochrome P450 enzymes (e.g., CYP17A1) in steroid hormone synthesis .

Detoxification and Redox Chains

  • Cytochrome P450 Catalysis: Enhances oxidative metabolism of xenobiotics (e.g., benzamidoxime, sulfamethoxazole hydroxylamine) .

  • Methemoglobin Reduction: Maintains hemoglobin in reduced form, preventing cyanosis .

N-Reductive Activity

Cyb5b, with cytochrome b5 reductase (CYB5R), reduces N-oxygenated compounds (e.g., benzamidoxime to benzamidine) in hepatoma cells and murine livers .

Expression and Regulation

  • Glucose Dependency: Cyb5b expression in hepatoma cells is influenced by glucose levels, with fasting reducing its abundance .

  • Chemical Inducers/Inhibitors:

    • Bisphenol A: Alters Cyb5b mRNA levels (dose-dependent effects) .

    • Cisplatin/Nimesulide: Upregulate Cyb5b expression in rat models .

Viral Homologs and Evolutionary Insights

While not directly related to rat Cyb5b, viral cytochrome b5 homologs (e.g., in Mimivirus) share structural conservation but lack sequence similarity to host proteins, raising questions about their evolutionary origin .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cyb5b; Cyb5m; Omb5; Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-146
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
NGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWAYWIVPIVGAILIGFLYRHFWADSKSS
Uniprot No.

Target Background

Function

Cytochrome b5 is a membrane-bound hemoprotein that functions as an electron carrier for various membrane-bound oxygenases.

Gene References Into Functions
  1. A novel reductive enzyme system crucial for lipid synthesis, exclusively located in the outer mitochondrial membrane, comprises CYB5B, MOSC2, and an unidentified component (a CYB5B reductase). PMID: 22203676
  2. Comparative X-ray crystallography of human and rat CYB5B reveals a significant structural difference in packing involving the five-strand beta-sheet, attributable to buried residue 21 in strand beta4. PMID: 21574570
  3. Molecular dynamics simulations have been conducted to characterize the physical properties of this protein. PMID: 12767127
  4. OMb, abundant in the zona glomerulosa (zG), contributes to aldosterone production in rat zG under angiotensin II stimulation via ascorbic acid regeneration. PMID: 15666805
Database Links
Protein Families
Cytochrome b5 family
Subcellular Location
Mitochondrion outer membrane.

Q&A

What is rat Cytochrome b5 type B and how does it differ from other cytochrome b5 isoforms?

Rat Cytochrome b5 type B (Cyb5b) is a heme-containing protein primarily located in the outer mitochondrial membrane, distinguishing it from the microsomal cytochrome b5 isoform found in the endoplasmic reticulum. This outer mitochondrial membrane cytochrome b5 possesses unique physicochemical, spectral, and immunochemical properties that differ from its microsomal counterpart. One notable distinction lies in the heme orientational disorder; rat outer mitochondrial cytochrome b5 exhibits a 1:1 ratio of isomers A and B, whereas rat microsomal cytochrome b5 shows a 1.6:1 ratio . These differences in structural characteristics contribute to their specialized functions within different cellular compartments and interaction networks.

What are the primary functional roles of rat Cyb5b in cellular metabolism?

Rat Cyb5b serves as an electron transfer protein in various metabolic pathways. It functions as an intermediate in electron transfer chains, particularly in its interactions with cytochrome P450 enzymes and NADPH:cytochrome P450 reductase. These interactions are critical for numerous metabolic processes, including drug metabolism, fatty acid desaturation, and steroid biosynthesis. The protein's ability to transfer electrons makes it an essential component in oxidation-reduction reactions within the mitochondrial membrane environment. Additionally, cytochrome b-type proteins are involved in physiological processes such as oxygen sensing mechanisms and potentially contribute to redox signaling pathways .

What are the optimal conditions for expressing recombinant rat Cyb5b in Escherichia coli?

The optimization of expression conditions for rat outer mitochondrial cytochrome b5 in E. coli can yield remarkably high levels of functional protein, reaching up to 10^4 nmol of hemeprotein per liter of culture . Successful expression strategies typically involve selecting appropriate E. coli strains (often BL21(DE3) derivatives), optimizing induction parameters (IPTG concentration, temperature, and induction time), and incorporating heme precursors in the growth medium to ensure proper incorporation into the recombinant protein. Temperature reduction during induction (typically to 25-30°C) often improves the yield of correctly folded protein by reducing inclusion body formation. The expression vector design should include appropriate promoter systems and fusion tags to facilitate both expression and subsequent purification.

What purification techniques yield the highest purity recombinant rat Cyb5b?

Metal-affinity chromatography represents the primary purification method for recombinant rat Cyb5b when the protein is expressed with an appropriate affinity tag (typically His-tag) . This approach allows for efficient single-step purification from cell lysates with high recovery rates. A typical purification protocol involves:

  • Cell lysis through sonication or mechanical disruption in appropriate buffer systems

  • Clarification of lysate by high-speed centrifugation

  • Loading the supernatant onto a metal-affinity column (Ni-NTA or similar)

  • Washing with increasing imidazole concentrations to remove weakly bound contaminants

  • Elution of purified Cyb5b with high imidazole buffer

For applications requiring exceptionally high purity, additional purification steps may include ion-exchange chromatography, size exclusion chromatography, or hydrophobic interaction chromatography. The purified protein should be characterized for its spectral properties to confirm proper heme incorporation and protein folding.

What spectroscopic methods are most informative for characterizing recombinant rat Cyb5b?

Several spectroscopic techniques provide valuable information about the structural integrity and functional properties of recombinant rat Cyb5b:

  • UV-Visible Spectroscopy: The reduced form of cytochrome b5 exhibits characteristic alpha, beta, and Soret peaks at approximately 557, 527, and 425 nm, respectively . These spectral features confirm proper heme incorporation and protein folding.

  • Circular Dichroism (CD): Provides information about secondary structural elements and can verify proper protein folding.

  • Nuclear Magnetic Resonance (NMR): Offers atomic-level insights into protein structure and dynamics, particularly useful for studying protein-protein interactions .

  • Electron Paramagnetic Resonance (EPR): Valuable for characterizing the electronic properties of the heme iron center.

These methods collectively provide comprehensive structural and functional verification of the recombinant protein, ensuring its suitability for downstream applications.

How does heme orientation in recombinant rat Cyb5b affect its functional properties?

Heme orientational disorder is a significant characteristic of cytochromes b5, with the heme group capable of binding in two distinct orientations (isomers A and B). In recombinant rat outer mitochondrial cytochrome b5, the heme is initially incorporated as a statistical 1:1 mixture of these isomers . Unlike microsomal cytochrome b5 isoforms, which undergo spontaneous isomerization toward an equilibrium favoring isomer A, the outer mitochondrial cytochrome b5 maintains this 1:1 ratio even after prolonged incubation at room temperature. This suggests that the heme is kinetically trapped in its initial orientation within the protein matrix.

The functional implications of this phenomenon include potential differences in electron transfer efficiency, redox potential, and protein-protein interaction dynamics. Researchers should be aware that this property distinguishes the mitochondrial isoform from its microsomal counterpart and may influence experimental outcomes when studying electron transfer reactions.

How does rat Cyb5b interact with electron transfer partners like NADPH:cytochrome P450 reductase?

Rat Cyb5b engages in specific interactions with electron transfer partners, particularly NADPH:cytochrome P450 reductase. These interactions are predominantly hydrophobic in nature, although the contribution of these hydrophobic interactions differs between cytochrome b5 isoforms . Immobilized recombinant mitochondrial cytochrome b5 serves as an excellent affinity ligand for studying these protein-protein interactions in vitro.

The interaction interface involves specific regions of the cytochrome b5 structure, with evidence suggesting that these interaction surfaces may differ between various electron transfer partners. For instance, studies with human cytochrome b5 indicate that different P450 enzymes interact with distinct surfaces of the cytochrome b5 protein . By analogy, rat Cyb5b likely employs specific structural elements for recognition of its electron transfer partners.

What methodological approaches can elucidate the structural basis of rat Cyb5b interactions?

Several complementary approaches provide insights into the structural basis of rat Cyb5b interactions:

  • Affinity Chromatography: Immobilized recombinant Cyb5b can serve as an affinity ligand to isolate and identify interaction partners .

  • Nuclear Magnetic Resonance (NMR): Solution NMR can identify specific residues involved in protein-protein interactions by monitoring chemical shift perturbations upon complex formation .

  • Site-Directed Mutagenesis: Systematic mutation of surface residues can identify key interaction determinants by assessing their impact on binding affinity and electron transfer efficiency.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify residues in close proximity at protein-protein interfaces.

  • Computational Docking: Molecular modeling approaches can predict interaction interfaces and guide experimental design.

These approaches, when used in combination, provide a comprehensive understanding of the structural basis for rat Cyb5b interactions with its electron transfer partners.

How does rat Cyb5b influence cytochrome P450-mediated reactions?

The influence of cytochrome b5 on cytochrome P450-mediated reactions is complex and depends on multiple factors including the specific P450 isoform, the substrate being metabolized, and the experimental conditions. Cytochrome b5 can facilitate, inhibit, or have no effect on P450 catalysis . This modulatory effect occurs through several potential mechanisms:

  • Direct electron transfer to P450 enzymes

  • Allosteric effects on P450 conformation

  • Formation of productive enzyme complexes

  • Enhancement of the second electron transfer in the P450 catalytic cycle

Studies with human P450 enzymes have shown that cytochrome b5 differentially affects various P450-mediated reactions. For instance, it stimulates CYP2E1-mediated oxidation of numerous substrates but has less influence on CYP2D6-mediated reactions . By analogy, rat Cyb5b likely exhibits similar substrate- and P450 isoform-dependent effects on catalytic activities.

What experimental systems best demonstrate the electron transfer function of rat Cyb5b?

Several experimental systems effectively demonstrate the electron transfer function of rat Cyb5b:

  • Reconstituted Systems: Purified recombinant rat Cyb5b can be incorporated into reconstituted systems containing P450 enzymes and NADPH:cytochrome P450 reductase to assess its impact on substrate metabolism.

  • Superoxide Production Assays: Cytochrome b5 proteins function as NAD(P)H oxidoreductases, generating superoxide in the presence of air and excess NAD(P)H . This activity can be measured using superoxide-sensitive probes.

  • Cytochrome c Reduction Assays: The ability of cytochrome b5 to transfer electrons can be demonstrated by monitoring the reduction of cytochrome c in vitro .

  • Spectroscopic Monitoring: The reduction of cytochrome b5 by NAD(P)H can be directly monitored spectroscopically by observing the characteristic spectral changes associated with heme reduction.

These experimental approaches provide complementary information about the electron transfer capabilities of rat Cyb5b under different conditions.

How do specific mutations affect the functional properties of recombinant rat Cyb5b?

Mutations in key residues of cytochrome b5 can significantly alter its functional properties, including electron transfer efficiency, protein stability, and interaction with partner proteins. By analogy with studies on cytochrome b5 reductase, mutations in critical regions of rat Cyb5b could affect:

  • Heme binding and orientation

  • Redox potential of the heme iron

  • Protein stability and folding

  • Recognition of electron transfer partners

For instance, studies with cytochrome b5 reductase have shown that mutations in the hinge or linker region between functional domains significantly reduce enzymatic activity and alter affinity for both NADH and NAD+ . Similar structure-function relationships likely exist for rat Cyb5b, where mutations in key residues would affect its functional properties.

How can recombinant rat Cyb5b be incorporated into in vitro drug metabolism studies?

Recombinant rat Cyb5b can be incorporated into in vitro drug metabolism studies through several approaches:

  • Reconstituted Systems: Purified rat Cyb5b can be combined with rat P450 enzymes and NADPH:cytochrome P450 reductase in phospholipid vesicles or nanodiscs to create defined systems for studying drug metabolism.

  • Supersomes or Baculosomes: Co-expression of rat Cyb5b with P450 enzymes and reductase in insect cells creates membrane preparations with defined protein components for metabolism studies.

  • Hepatocyte Systems: Transgenic expression or knockdown of Cyb5b in primary rat hepatocytes allows evaluation of its role in a more physiologically relevant cellular context.

These systems enable researchers to evaluate the specific contribution of Cyb5b to the metabolism of various xenobiotics, including pharmaceuticals, environmental contaminants, and endogenous compounds. The inclusion of Cyb5b often enhances the metabolic activity and provides a more complete representation of in vivo drug metabolism pathways.

What are the implications of rat Cyb5b in species-specific drug metabolism differences?

Species differences in drug metabolism often arise from variations in cytochrome P450 enzymes and their regulatory proteins, including cytochrome b5. Rat Cyb5b may contribute to species-specific metabolism patterns through several mechanisms:

  • Differential Expression: Variations in the tissue-specific expression levels of Cyb5b between species

  • Structural Differences: Amino acid variations that affect interaction with P450 enzymes

  • Regulatory Mechanisms: Different post-translational modifications or regulatory pathways

Understanding these species differences is critical for translating findings from rat models to human drug metabolism. Comparative studies of rat and human Cyb5b can identify conserved and divergent aspects of their function, providing insights into the applicability of rat models for predicting human drug metabolism. Researchers should consider these species differences when designing experiments and interpreting results from rat-based drug metabolism studies.

What are common challenges in expressing active recombinant rat Cyb5b and how can they be addressed?

Common challenges in expressing active recombinant rat Cyb5b include:

  • Insufficient Heme Incorporation: Supplementing the growth medium with heme precursors (δ-aminolevulinic acid) or hemin can enhance proper heme incorporation.

  • Protein Aggregation: Lowering the induction temperature (to 16-25°C) and using specialized E. coli strains designed for membrane protein expression can reduce aggregation.

  • Low Solubility: Fusion tags (such as MBP or SUMO) can enhance solubility, while detergents or lipid nanodiscs may be necessary for working with the full-length membrane-anchored form.

  • Improper Folding: Co-expression with molecular chaperones and optimization of expression conditions can improve the yield of correctly folded protein.

  • Proteolytic Degradation: Including protease inhibitors during purification and designing constructs resistant to proteolysis can minimize degradation.

Systematic optimization of expression and purification conditions, as demonstrated in the literature where expression levels up to 10^4 nmol per liter of culture have been achieved , can address these challenges and yield functional recombinant protein suitable for downstream applications.

How can the stability of purified recombinant rat Cyb5b be maximized during storage and experimentation?

Maximizing the stability of purified recombinant rat Cyb5b requires careful attention to storage conditions and buffer composition:

  • Storage Temperature: Store the purified protein at -80°C for long-term storage or at -20°C for medium-term storage with minimal freeze-thaw cycles.

  • Buffer Composition:

    • Include glycerol (10-20%) to prevent freeze-damage

    • Maintain physiological pH (typically 7.0-7.5)

    • Add reducing agents (DTT or β-mercaptoethanol) to prevent oxidation

    • Consider adding specific stabilizers based on experimental requirements

  • Lyophilization: For extremely long-term storage, lyophilization with appropriate cryoprotectants can be considered.

  • Aliquoting: Prepare small aliquots to avoid repeated freeze-thaw cycles.

  • Monitoring Stability: Regularly verify protein integrity through spectroscopic analysis, checking the characteristic absorption peaks of properly folded cytochrome b5.

These measures ensure that the purified recombinant rat Cyb5b maintains its structural integrity and functional properties throughout storage and experimental procedures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.