Recombinant Rat Cytochrome b5 (Cyb5a)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us for preferential development.
If you require a specific tag, please inform us for preferential development.
Synonyms
Cyb5a; Cyb5; Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-134
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Cyb5a
Target Protein Sequence
AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE
NFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISAL
VVALMYRLYMAED
Uniprot No.
Target Background
Function
Cytochrome b5 is a membrane-bound hemoprotein that functions as an electron carrier for various membrane-bound oxygenases. It also plays a crucial role in several steps of the sterol biosynthesis pathway, specifically in the introduction of the C-6 double bond during C-6 desaturation.
Gene References Into Functions
- 1.
- Cygb exhibits nitric-oxide dioxygenase activity, with ascorbate and cytochrome b5 acting as reductants. PMID: 20511233
- 2.
- Chemical shift-based constraints for solution structure determination of cytochrome b5. PMID: 11941499
- 3.
- Hydrophobic clusters contribute to the enhanced stability of rat outer mitochondrial membrane Cyb5, resulting in higher kinetic barriers for hemin release and reorientation compared to bovine microsomal apocyt b5. PMID: 12269800
- 4.
- Outer mitochondrial membrane cytochrome b5, not the microsomal membrane form, functions as an activator for androgenesis in rat Leydig cells. PMID: 12668680
- 5.
- Cytochrome b5 integrates into the ER membrane via a loosely bound state. The three amino acids -Leu-Met-Tyr- are crucial for transitioning to a firmly integrated state. PMID: 12761189
- 6.
- Co-expression of rat endoplasmic reticulum cytochrome b5 with wild-type desaturase resulted in protein interaction and a significant increase in Δ6-desaturase activity. PMID: 14563830
- 7.
- The cytochrome b5 mutation D60R stabilized the holoprotein, likely due to enhanced helical propensity or improved electrostatic interactions. PMID: 15379561
- 8.
- Simulations provided microscopic explanations for differences in physical properties between outer mitochondrial membrane CYB5, microsomal CYB5, and two mutants, in terms of localized structural and flexibility changes. PMID: 16807901
- 9.
- Data distinguished the four helical segments and provided insight into holo- and nonholo-like interactions in the cytochrome's heme binding site. PMID: 18398853
- 10.
- The effect of the His63-iron bond and heme plane proximity on helical conformation population in H4 and H5 of cytochrome b5 was investigated. PMID: 18398854
- 11.
- The hydrophobic domain of cytochrome b5 participates in both hemeprotein interaction and electron transfer from cytochrome b5 to cytochrome P4503A4. PMID: 19817686
Database Links
Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
