Recombinant Rat Cytochrome P450 4V2 (Cyp4v2)

Shipped with Ice Packs
In Stock

Description

General Characteristics of Cytochrome P450 Enzymes

Cytochrome P450 enzymes are hemoproteins, characterized by a distinctive spectral absorption peak at approximately 450 nm when in the reduced state and bound to carbon monoxide . These enzymes are primarily membrane-bound, located in the endoplasmic reticulum of cells, particularly in the liver . They catalyze a wide array of reactions, most notably monooxygenation, where one atom of molecular oxygen is inserted into a substrate, and the other is reduced to water .

The CYP4 Family

The CYP4 family is a group of cytochrome P450 enzymes that primarily metabolize fatty acids and other lipids . These enzymes are involved in:

  • $$\omega$$-oxidation of fatty acids

  • The metabolism of prostaglandins and leukotrienes, which are important signaling molecules involved in inflammation and immune responses

  • The synthesis of hormones and other bioactive lipids

Research Applications

Recombinant Cyp4v2 can be used in various in vitro and in vivo studies, including:

  • Drug Metabolism Studies: Assessing how Cyp4v2 interacts with and metabolizes various drug candidates.

  • Toxicology Studies: Determining the role of Cyp4v2 in the bioactivation or detoxification of xenobiotics.

  • Enzyme Inhibition Studies: Identifying potential inhibitors of Cyp4v2, which could be relevant in drug development or understanding metabolic pathways .

  • Protein Quantification: Development of methods for the absolute quantification of CYP isoforms, including Cyp4v2, in rat liver microsomes .

Relevant Findings

  • Induction Studies: Studies have shown that the expression of CYP4 enzymes can be induced by certain compounds. For example, chloroxoquinoline induces CYP3A and CYP1A expression in rat hepatocytes .

  • Species Differences: There are notable species-dependent differences in CYP4 expression and induction. For instance, certain treatments induce different P450 isoforms in rat and mouse livers .

  • Inhibition: Cytochrome P450 4A (CYP4A) functions as a fatty acid hydroxylase, and inhibiting CYP4A effectively improves metabolic dysfunction-associated fatty liver disease by reducing hepatic steatosis, inflammation, and fibrosis .

Quantitative Analysis of CYP Enzymes

Mass spectrometry-based methods have been developed for the simultaneous quantification of multiple rat CYP isoforms . These methods involve:

  • Sample Preparation: Isolation of microsomes from rat livers.

  • LC-MS/MS Analysis: Liquid chromatography-tandem mass spectrometry to quantify specific CYP proteins using surrogate peptides.

  • Validation: Ensuring the accuracy, precision, and linearity of the method .

    Table 1. Method Validation for Quantification of CYP Isoforms

    ParameterCYP1A2CYP2C11CYP2D1CYP2B1CYP3A1CYP2C6CYP2E1
    LLOQ (nM)5550.50.522
    Precision (RSD, %)< 15< 15< 15< 15< 15< 15< 15
    Accuracy (RE, %)80-12080-12080-12080-12080-12080-12080-120

    LLOQ = Lower Limit of Quantification, RSD = Relative Standard Deviation, RE = Relative Error

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cyp4v2; Cyp4v3; Cytochrome P450 4V2; Docosahexaenoic acid omega-hydroxylase CYP4V2; Long-chain fatty acid omega-monooxygenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLWLWLGLSGQKLLLWGAASAVSVAGATVLLNILQMLVSYARKWQQMRPIPSVARAYPLV GHALFMKPNNTEFFQQIIQYTEEFRHLPIIKLWIGPVPLVALYKAENVEVILTSSKQIDK SFMYKFLQPWLGLGLLTSTGSKWRARRKMLTPSFHFTILEDFLDVMNEQANILVNKLEKH VNQEAFNCFFPITLCALDIICETAMGKNIGAQSNGDSEYVRTVYRMSDMIYRRMKMPWFW FDLWYLMFKEGRDHKKGLKSLHTFTNNVIAERVNARKAEQDCIGAGRGPLPSKTKRKAFL DLLLSVTDEEGNKLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQRKVDKELD DVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVAGYKISKGTEAV IIPYALHRDPRYFPDPEEFQPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI LACILREFWIESNQKREELGLAGDLILRPNNGIWIKLKRRHEDDP
Uniprot No.

Target Background

Function
Recombinant Rat Cytochrome P450 4V2 (CYP4V2) is a cytochrome P450 monooxygenase involved in ocular fatty acid metabolism. It catalyzes the ω-hydroxylation of polyunsaturated fatty acids (PUFAs), including docosahexaenoate (DHA) and its precursor eicosapentaenoate (EPA), contributing to retinal PUFA homeostasis. It also ω-hydroxylates saturated fatty acids such as laurate, myristate, and palmitate, with catalytic efficiency decreasing in the order: myristate > laurate > palmitate (C14 > C12 > C16). Mechanistically, CYP4V2 utilizes molecular oxygen, incorporating one oxygen atom into the substrate and reducing the second to water, using two electrons supplied by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Gene References Into Functions
  1. Increased tissue kallikrein mRNA expression is observed during prenatal and early postnatal development in rat brain. PMID: 12025956
Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Cytochrome P450 4V2 (CYP4V2) and what is its function in rats?

CYP4V2 is a member of the cytochrome P450 enzyme family, specifically belonging to family 4, subfamily V. In rats, it functions as a fatty acid omega hydroxylase, playing a crucial role in lipid metabolism by catalyzing the oxidation of fatty acids. The enzyme is particularly important in the retinal pigment epithelium, where mutations in humans are associated with Bietti crystalline dystrophy (BCD) . The rat CYP4V2 shares approximately 56% sequence identity with the human ortholog, making it a valuable model for studying the enzyme's function .

What are the common methods for detecting CYP4V2 expression in rat tissues?

Several validated methods are available for detecting and quantifying CYP4V2 in rat tissues:

MethodApplicationSensitivitySample TypesNotes
ELISAQuantitative detection<0.07 ng/mlTissue homogenates, cell lysates, biological fluidsTest range: 0.156-10 ng/ml
Western BlotProtein expression levelsVariableCell/tissue lysatesUseful for comparing expression between samples
ImmunocytochemistryCellular localizationVariableFixed cells/tissuesVisualizes protein distribution
qPCRmRNA expressionHighRNA extractsMeasures transcript levels

The choice of method depends on the specific research question, with ELISA offering high sensitivity for quantitative measurements, while immunocytochemistry provides valuable information about subcellular localization.

What are the optimal conditions for expressing recombinant rat CYP4V2 in different expression systems?

Based on current research, several expression systems have been successfully used for recombinant rat CYP4V2:

Expression SystemVectorOptimization StrategyValidation MethodRelative Yield
HEK293 cellsAAV2Codon optimizationICC, Western blotHigh
ARPE19 cellsAAV2Codon optimizationICC, Western blotHigh
iPSC-derived RPE cellsAAV2Codon optimizationICC, Western blotModerate

Research indicates that codon-optimized CYP4V2 sequences (AAV2.coCYP4V2) show significantly higher expression levels and enzymatic activity compared to wild-type sequences (AAV2.wtCYP4V2) . When expressing recombinant CYP4V2, researchers should consider the incorporation of heme, as it is essential for proper enzyme folding and activity .

How can codon optimization improve the expression and function of recombinant rat CYP4V2?

Codon optimization has been demonstrated to significantly enhance both expression levels and enzymatic activity of recombinant rat CYP4V2. When HEK293, ARPE19, and patient iPSC-derived RPE cells were transduced with AAV2 vectors encoding codon-optimized CYP4V2 (AAV2.coCYP4V2), they showed elevated protein expression compared to cells transduced with wild-type CYP4V2 (AAV2.wtCYP4V2) . This enhancement was confirmed through both immunocytochemistry and western blot analysis.

Moreover, enzyme activity assays revealed significantly increased CYP4V2 catalytic function in cells expressing the codon-optimized variant . This improvement likely results from optimizing the codon usage to match the tRNA pool of the expression host, which enhances translation efficiency and may improve protein folding kinetics.

How can molecular modeling be used to predict the effects of mutations in rat CYP4V2?

Molecular modeling approaches provide valuable insights into how mutations affect CYP4V2 structure and function:

  • Homology modeling uses known crystal structures (such as human CYP2D6) as templates to predict rat CYP4V2 structure through sequence alignment and secondary structure prediction .

  • Force field analysis (using frameworks like Amber99 and Charmm27) enables the generation of robust structural models .

  • Mutation effect analysis can predict how specific mutations impact:

    • Hydrogen bonding networks

    • Alpha helix distortion

    • Positioning of the heme group and catalytic site

    • Substrate binding pocket geometry

Recent studies have shown that BCD-causing mutations primarily impact the transmembrane domain by altering hydrogen bonds and subsequent distortion of the alpha helices, influencing the porphyrin ring and changing the positioning of the heme group at the enzyme's catalytic site .

What are the species-specific differences in substrate selectivity between rat and human CYP4V2?

  • Binding pocket size and shape

  • Substrate orientation within the active site

  • Interaction with the heme group

  • Catalytic efficiency for specific substrates

Molecular recognition in Cytochrome P450 enzymes results from a number of non-specific interactions in a large binding site, allowing for species variation in substrate preference . When using rat models to study CYP4V2-related human diseases, these species differences must be carefully considered when interpreting results and extrapolating to human physiology.

How can AAV-mediated gene delivery be optimized for CYP4V2 in rat models?

AAV-mediated delivery of CYP4V2 has been successfully demonstrated and can be optimized for rat models using several strategies:

Optimization ParameterRecommended ApproachExpected Outcome
Vector selectionAAV2 serotypeEffective transduction of target cells
Transgene designCodon-optimized CYP4V2Enhanced expression and activity
PromoterTissue-specific promotersTargeted expression
Delivery routeBased on target tissueImproved biodistribution
DosageTitration studies requiredBalance between efficacy and safety

Research has demonstrated that AAV2 vectors encoding codon-optimized CYP4V2 (AAV2.coCYP4V2) result in significantly higher protein expression and enzyme activity compared to wild-type CYP4V2 in various cell types, including HEK293, ARPE19, and iPSC-derived RPE cells .

What are the implications of CYP4V2 research in rats for understanding human diseases like Bietti crystalline dystrophy?

Research on rat CYP4V2 provides critical insights into human diseases associated with this enzyme:

  • Disease mechanism understanding: Studying how mutations affect rat CYP4V2 structure and function helps elucidate the molecular pathogenesis of Bietti crystalline dystrophy (BCD), a progressive inherited retinal disease caused by CYP4V2 mutations .

  • Therapeutic development: Preclinical evaluation of AAV2-mediated gene supplementation therapy using rat models supports the development of treatments for BCD, which currently has no effective therapies .

  • Mutation analysis: Comparative studies between wild-type and mutant forms of CYP4V2 in rats can reveal how specific mutations impact enzyme activity and cellular lipid metabolism .

  • Translational challenges: While rat models are valuable, the approximately 44% sequence divergence between rat and human CYP4V2 necessitates careful interpretation when translating findings to human disease contexts .

What bioinformatic tools are most effective for analyzing CYP4V2 mutations and variants?

A comprehensive suite of bioinformatic tools is available for analyzing CYP4V2 mutations:

Tool CategorySpecific ToolsApplication
Pathogenicity predictionSIFT, PolyPhenPredicting functional impact of missense mutations
Conservation analysisGrantham scores, PhyloPAssessing evolutionary conservation
Splice site analysisSpliceSite finder-like, MaxEntScan, NNSPLICE, Human Splicing FinderPredicting effects on splicing
Structural modelingMOE (Molecular Operating Environment)Generating 3D homology models
Population frequencyExAC, 1000 Genomes, dbSNP138Assessing variant rarity
Copy number variationqPCR assays, SNP chip arraysDetecting deletions/duplications

For comprehensive analysis of novel variants, researchers should employ multiple complementary approaches. For example, a recent study used genome-wide SNP array analysis combined with homozygosity mapping to identify a homozygous missense mutation in CYP4V2 (c.332T>C; p.Ile111Thr) in a consanguineous family initially diagnosed with atypical retinitis pigmentosa .

How can CRISPR-Cas9 be used to create rat models with specific CYP4V2 mutations?

Creating rat models with specific CYP4V2 mutations using CRISPR-Cas9 requires a systematic approach:

  • Design phase:

    • Select target mutations based on human BCD-causing variants identified in patients

    • Design sgRNAs with high specificity for the rat CYP4V2 locus

    • Create HDR donor templates containing the desired mutation

  • Validation phase:

    • Test sgRNA efficiency in rat cell lines

    • Optimize CRISPR components and delivery methods

  • In vivo editing:

    • Microinject CRISPR components into rat zygotes

    • Transfer to pseudopregnant females

    • Screen offspring for desired mutations

  • Phenotypic characterization:

    • Analyze CYP4V2 expression and activity

    • Assess lipid profiles in relevant tissues

    • Evaluate retinal morphology and function

    • Compare to human BCD phenotypes

This approach allows researchers to create precise genetic models that recapitulate human disease-causing mutations, enabling detailed investigation of CYP4V2 function in vivo.

How can structural studies of rat CYP4V2 contribute to drug development for CYP4V2-related diseases?

Structural studies of rat CYP4V2 can significantly advance drug development through several approaches:

  • Structure-based drug design: Detailed structural information about the CYP4V2 active site can guide the rational design of small molecule modulators that restore function to mutant enzymes or enhance wild-type activity.

  • Mutation impact analysis: By modeling the structural consequences of disease-causing mutations, researchers can identify specific structural changes that might be targeted by therapeutic interventions .

  • Species comparison: Structural comparisons between rat and human CYP4V2 can reveal conserved regions that might serve as optimal drug targets, increasing the translational relevance of findings in rat models .

  • Binding site characterization: Understanding the detailed architecture of the CYP4V2 substrate binding pocket can facilitate the development of selective inhibitors or substrates that modify enzyme activity in therapeutically beneficial ways.

Research has shown that BCD-causing mutations in CYP4V2 impact the transmembrane domain, altering hydrogen bonds and distorting alpha helices that influence the porphyrin ring and heme positioning , providing potential structural targets for therapeutic intervention.

What are the current limitations in detecting and quantifying CYP4V2 enzyme activity in rat tissues?

Several technical challenges exist in accurately measuring CYP4V2 activity:

ChallengeImpactPotential Solutions
Low endogenous expressionDifficult detectionConcentration/enrichment methods, more sensitive assays
Substrate specificityUnclear which substrates to useMetabolomic approaches to identify physiological substrates
Assay standardizationDifficult to compare between studiesDevelopment of standard reference materials
Species differencesRat substrates may differ from humanComparative substrate screening studies
Post-translational modificationsMay affect activity measurementsCharacterization of native enzyme modifications

Current research indicates that codon-optimized CYP4V2 expression systems can significantly improve enzyme activity detection compared to wild-type constructs , suggesting that optimized expression systems may provide solutions for some of these challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.