Recombinant Rat cytomegalovirus G-protein coupled receptor homolog R33

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Cytomegalovirus G-Protein Coupled Receptor Homolog R33

Recombinant Rat cytomegalovirus G-protein coupled receptor homolog R33 (pR33) is a synthetic protein derived from the R33 gene of rat cytomegalovirus (RCMV), a member of the betaherpesvirus family. This receptor belongs to the UL33-like GPCR family conserved across all betaherpesviruses, including human cytomegalovirus (HCMV) and murine cytomegalovirus (MCMV) . pR33 functions as a constitutively active GPCR, modulating intracellular signaling pathways to facilitate viral dissemination and pathogenesis .

Constitutive Signaling and Pathway Activation

pR33 exhibits agonist-independent signaling, activating multiple G proteins:

  • Gαq/11 coupling: Triggers PLC-β activation, leading to PKC-driven CREB phosphorylation .

  • Gαi/o coupling: Inhibits CRE-mediated transcription and enhances NF-κB activity (pertussis toxin-sensitive) .

  • G Protein-Independent Pathways: Activates p38 MAPK and NF-κB through non-canonical mechanisms .

Role in Viral Pathogenesis

Deletion of R33 (RCMVΔR33) results in:

ParameterRCMVΔR33 vs. Wild-Type RCMVSource
Salivary Gland InfectionUndetectable virus titers vs. >10⁴ PFU/ml .
Mortality100% survival vs. <50% survival in rats .
Systemic SpreadReduced viral load in organs (e.g., liver, spleen) .

Applications in Research

ApplicationDetailsSource
Signaling StudiesUsed to map GPCR-G protein interactions and constitutive activation .
Viral Tropism ModelsInvestigates mechanisms of salivary gland targeting in CMV infections .
Therapeutic TargetsPotential for antiviral strategies targeting pR33-mediated signaling .

Significance and Future Directions

pR33 is a critical virulence factor in RCMV pathogenesis, enabling salivary gland tropism and systemic dissemination . Its constitutive signaling properties make it a valuable tool for studying GPCR-mediated immune modulation. Future research may focus on:

  • Structural Determinants: Residues critical for G protein coupling (e.g., R131, RR motif) .

  • Therapeutic Interventions: Inhibitors targeting pR33’s PLC-PKC or NF-κB pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
G-protein coupled receptor homolog R33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Rat cytomegalovirus (strain Maastricht)
Target Protein Sequence
MDVLLGTEELEDELHQLHFNYTCVPSLGLSVARDAETAVNFLIVLVGGPMNFLVLATQML SNRSYSVSTPTLYMTNLYLANLLTVATLPFLMLSNRGLVGSSPEGCKIAALAYYATCTAG FATLMLIAINRYRVIHQRTRSGAGSKRQTYAVLAVTWLASLMCASPAPLYATVMAHDSAD ALAFETCIIYFSYDQVKTVLATFKILITMIWGITPVVMMSWFYVFFYRRLKLTSYRRRSQ TLTFVTTLMLSFLVVQTPFVAIMSYDSYGVLNWPINCDTINKRDAVSMLARVVPNFHCLL NPVLYAFLGRDFNKRFILCISGKLFSRRRALRERAGLGAQIVGPVCALPSKTVTLSEETR DLSQEIRRLRALGRPPPPPPPPPPPNC
Uniprot No.

Target Background

Function
Plays an important role in vivo, particularly in the dissemination to or replication within the salivary gland.
Database Links

KEGG: vg:940282

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What is the RCMV R33 gene and what protein structure does it encode?

The rat cytomegalovirus (RCMV) R33 gene encodes a 387-amino-acid polypeptide with a predicted molecular mass of 43.2 kDa . This protein (pR33) belongs to the G protein-coupled receptor (GPCR) family and shows sequence similarity with chemokine-binding GPCRs . The amino acid sequence of pR33 is highly similar to proteins encoded by MCMV M33 gene (65% identity) and HCMV UL33 gene (40% identity) .

The pR33 protein contains multiple transmembrane domains characteristic of GPCRs. Unlike some viral homologs such as those in HHV-6 and HHV-7, RCMV R33 transcripts are likely not spliced near the 5' end, as determined by RT-PCR analysis of poly(A)+ RNA from RCMV-infected cells . The protein contains several key functional domains, including an NRY motif (at amino acids 130-132) that serves as the counterpart of the common DRY motif found in cellular GPCRs .

How does the R33-encoded GPCR signal in cellular systems?

The R33-encoded protein (pR33) functions as a GPCR that signals in an agonist-independent, constitutive manner in both COS-7 and Rat2 cells . When expressed in these cellular systems, pR33 constitutively activates phospholipase C (PLC) through coupling to G proteins of the Gq/11 family .

The signaling pathway involves:

  • Constitutive (ligand-independent) activation of the receptor

  • Coupling to Gq/11 proteins

  • Activation of phospholipase C

  • Subsequent phosphatidylinositol turnover

The constitutive signaling activity is a distinctive feature of pR33 and contributes to its biological functions in the viral life cycle . Additionally, pR33 can signal through Gi/0-mediated pathways, demonstrating its ability to couple to multiple G protein families .

What is the significance of R33 in RCMV pathogenesis?

The R33 gene plays a critical role in RCMV pathogenesis, particularly in viral dissemination and replication in specific tissues. Key findings include:

  • An RCMV strain with R33 deleted (RCMVΔR33) is severely attenuated in vivo .

  • RCMVΔR33 is unable to either enter or replicate in the salivary glands of infected rats .

  • Rats infected with RCMVΔR33 show significantly lower mortality than those infected with wild-type RCMV .

  • R33-deficient RCMV shows delayed progression to chronic rejection in rat heart transplant recipients compared to wild-type RCMV .

How is R33 evolutionarily related to other cytomegalovirus GPCR homologs?

The R33 gene belongs to a family of GPCR homologs conserved among all betaherpesviruses . This family includes:

VirusGPCR HomologSequence Identity with pR33
RCMVR33100%
MCMVM3365%
HCMVUL3340%
HHV-6U12Lower identity (exact % not provided)
HHV-7U12 homologLower identity (exact % not provided)

Functional conservation exists across these homologs, despite sequence differences. For instance, HCMV UL33 can partially compensate for the lack of M33 in vivo, suggesting conserved biological roles within this gene family . The HHV-6B member of this family, pU12, has been reported to function as a calcium-mobilizing receptor for several CC-chemokines, though the exact ligand specificity of R33 remains less clear .

How do mutations in the NRY motif affect pR33 signaling properties?

The NRY motif (at amino acids 130-132) of pR33 is the counterpart of the common DRY motif found in cellular GPCRs and plays a crucial role in G protein coupling and signaling . Mutational analysis of this motif reveals:

  • N130D mutation (asparagine to aspartic acid) results in signaling characteristics similar to wild-type pR33, indicating that N130 is not the determinant of constitutive activity .

  • N130A mutation (asparagine to alanine) severely impairs Gq/11-mediated constitutive activation of phospholipase C, while maintaining similar levels of Gi/0-mediated signaling compared to wild-type pR33 .

  • R131A mutation (arginine to alanine) completely abolishes constitutive activity, indicating that R131 is critical for pR33 function in vitro .

  • Y132F and Y132A mutations (tyrosine to phenylalanine or alanine) display similar activities to the wild-type receptor, suggesting Y132 is not critical for function .

These findings demonstrate the differential importance of residues within the NRY motif for pR33 signaling and reveal that distinct residues may control coupling to different G protein families.

What methodological approaches are used to study R33 mutations and signaling?

Research on R33 typically employs several methodological approaches:

  • Molecular Cloning and Mutagenesis:

    • Site-directed mutagenesis to generate point mutations in specific residues

    • PCR-based amplification using primers containing desired mutations

    • Cloning into expression vectors such as pcDNA3

  • Cell-Based Expression Systems:

    • Transient expression in COS-7 cells for signaling studies

    • Expression in Rat2 cells to study function in a more native context

    • Fluorescent tagging (e.g., GFP fusion constructs) to monitor cellular localization

  • Signaling Assays:

    • Phospholipase C activation assays to measure Gq/11-mediated signaling

    • CREB- and NFAT-mediated signaling assays using reporter constructs

    • Phosphatidylinositol turnover assays

  • Recombinant Virus Generation:

    • Construction of recombinant RCMV with mutations in R33

    • Deletion mutants (RCMVΔR33) to study loss-of-function effects

  • In Vivo Models:

    • Rat infection models to study pathogenesis

    • Organ-specific viral titer measurements, particularly in salivary glands

    • Heart transplant models to assess effects on rejection

How does the C-terminal domain contribute to pR33 function?

The C-terminal domain of pR33 plays important roles in receptor signaling and cell surface expression:

  • Two consecutive arginine residues within the C-terminal tails of both pR33 and its human CMV homolog pUL33 have been identified as important for correct cell-surface expression of these receptors .

  • Signaling studies of M33 (the mouse CMV homolog) show that specific C-terminal residues (A340 and A353) are important for CREB- and NFAT-mediated signaling, although not essential for phosphatidylinositol turnover . This suggests that the C-terminus has differential effects on various signaling pathways.

  • Experimental approaches to study C-terminal function include:

    • Truncation mutants to assess the importance of the entire domain

    • Site-directed mutagenesis of specific residues

    • C-terminal tagging with fluorescent proteins to monitor localization

When designing experiments to study C-terminal function, researchers should consider both trafficking/localization effects and direct signaling consequences of mutations in this region.

How can recombinant RCMV systems be used to study R33 function in vivo?

Recombinant RCMV systems provide powerful tools for studying R33 function in the context of viral infection:

  • Generating Recombinant Viruses:

    • Construction of RCMV with R33 deletion (RCMVΔR33)

    • Introduction of specific point mutations into the viral genome to study their effects in vivo

    • Creation of chimeric viruses expressing homologs from other species (e.g., replacing R33 with HCMV UL33)

  • Experimental Design for In Vivo Studies:
    When designing experiments with recombinant viruses, researchers should:

    • Define independent variables (virus strain: wild-type vs. mutant) and dependent variables (viral titers, pathogenesis markers)

    • Control extraneous variables (host genetics, immunosuppression status)

    • Use appropriate sample sizes for statistical power

    • Include controls for viral dose, route of infection, and timing of measurements

  • Applications in Pathogenesis Research:

    • Assessing viral dissemination to different organs, particularly salivary glands

    • Measuring mortality rates in immunocompromised hosts

    • Evaluating effects on transplant rejection models

    • Studying cell tropism and tissue-specific replication

  • Complementation Studies:

    • Testing whether homologs from other cytomegaloviruses (e.g., HCMV UL33, MCMV M33) can functionally replace R33

    • Investigating the ability of mutant forms of R33 to rescue phenotypes of RCMVΔR33

What are the functional differences between R33 and its homologs in other cytomegaloviruses?

Despite sequence conservation, functional differences exist between R33 and its homologs in other cytomegaloviruses:

  • Tissue Tropism Effects:

    • Both MCMV M33 and RCMV R33 are required for replication in salivary glands, but the mechanisms differ

    • M33 promotes extravasation of infected dendritic cells into salivary gland tissues

    • For R33, trafficking of virus to salivary glands occurs, but the virus fails to establish infection in the tissue

  • Constitutive Signaling Properties:

    • Both R33 and M33 display constitutive signaling activity

    • M33 constitutive activity is dependent on specific residues in TM II and TM III

    • Specific signaling pathways activated may differ between the homologs

  • Interchangeability:

    • HCMV UL33 can partially compensate for the lack of M33 in vivo

    • US28 (another HCMV GPCR) can also promote infected DC re-entry into circulation from the site of infection, similar to M33

  • Experimental Approaches to Compare Homologs:

    • Generation of chimeric receptors to identify domains responsible for functional differences

    • Complementation studies using recombinant viruses

    • Comparative signaling assays in standardized cellular systems

What experimental systems are optimal for studying recombinant R33 in vitro?

Several experimental systems have been successfully employed to study recombinant R33:

  • Cell Lines for Expression Studies:

    • COS-7 cells: Commonly used for transient expression and signaling studies

    • Rat2 cells: More physiologically relevant for studying RCMV proteins

    • HEK293 cells: Often used for high-level expression of recombinant GPCRs

  • Expression Vector Systems:

    • pcDNA3-based vectors for mammalian expression

    • Vectors with epitope tags (myc, HA) for detection and immunoprecipitation

    • GFP fusion constructs for visualization of cellular localization

  • Readout Assays for Function:

    • Calcium mobilization assays (Fluo-4, Fura-2) for Gq/11 signaling

    • Reporter gene assays (CREB, NFAT) for transcriptional activation

    • Phosphatidylinositol turnover assays for direct measurement of PLC activity

    • Co-immunoprecipitation to study interactions with G proteins

  • Recommended Controls:

    • Empty vector controls

    • Known constitutively active and inactive GPCR controls

    • Wild-type R33 as a positive control when testing mutants

    • Selective G protein inhibitors to confirm signaling pathways

How can researchers design effective mutation strategies to study R33 structure-function relationships?

To effectively study R33 structure-function relationships, researchers should consider the following mutation strategies:

  • Targeted Domain Mutations:

    • Focus on conserved motifs like the NRY domain (aa 130-132)

    • Target transmembrane domains, particularly TM II and TM III, which are known to be important in GPCR activation

    • Investigate the C-terminal domain, especially the consecutive arginine residues important for cell surface expression

  • Mutation Types to Consider:

    • Conservative substitutions (e.g., Y132F) to test the importance of specific chemical properties

    • Non-conservative substitutions (e.g., N130A) to more drastically alter residue properties

    • Alanine scanning mutagenesis across key domains

    • Chimeric constructs with homologous regions from other viral GPCRs

  • Experimental Design Approach:

    • Generate a panel of mutations rather than individual mutations

    • Include both predicted critical and non-critical residues as controls

    • Test multiple readouts for each mutant to assess pathway-specific effects

    • Confirm expression levels for all mutants before interpreting functional data

  • Analysis Methodology:

    Mutation TypePurposeExamples in R33 Research
    Point mutationsTest specific residue functionN130D, N130A, R131A, Y132F
    Domain swapsIdentify functional domainsN-terminal tagging/modification
    TruncationsTest importance of terminal regionsC-terminal truncations
    Conservative substitutionsTest chemical property requirementsY132F (maintains aromatic ring)

What are the critical considerations for designing in vivo experiments with R33-mutant RCMV?

When designing in vivo experiments with R33-mutant RCMV, researchers should consider:

  • Selection of Animal Model:

    • Rat strains (typically inbred) for consistency

    • Immunocompetent rats for normal infection course

    • Immunocompromised rats (through drug treatment or genetic background) to study severe disease

    • Transplantation models for rejection studies

  • Experimental Variables to Control:

    • Age and sex of animals

    • Viral dose and route of administration

    • Timing of tissue collection and analysis

    • Immunosuppression regimen when applicable

  • Key Measurements:

    • Viral titers in target organs, particularly salivary glands

    • Mortality rates and clinical signs

    • Inflammatory markers and immune responses

    • In transplant models: rejection markers and graft survival

  • Experimental Design Framework:

    • Follow systematic design principles with clearly defined variables

    • Use appropriate sample sizes based on power calculations

    • Include relevant controls (wild-type virus, mock infection)

    • Consider between-subjects vs. within-subjects designs

  • Ethical Considerations:

    • Use the minimum number of animals necessary for statistical power

    • Define humane endpoints for studies involving mortality

    • Obtain proper institutional approval for animal protocols

How can researchers address challenges in expressing and purifying recombinant R33 for structural studies?

Membrane proteins like R33 present significant challenges for expression and purification. Researchers should consider:

  • Expression Systems:

    • Mammalian cell systems (HEK293, CHO) for proper post-translational modifications

    • Insect cell systems (Sf9, Hi5) for higher expression levels

    • Yeast systems (Pichia pastoris) as an alternative for GPCR expression

    • Cell-free systems for difficult-to-express constructs

  • Construct Design Strategies:

    • N-terminal signal sequences to enhance membrane targeting

    • C-terminal tags positioned to avoid interference with function

    • Fusion partners (T4 lysozyme, BRIL) to enhance stability and crystallization

    • Thermostabilizing mutations based on homology to crystallized GPCRs

  • Solubilization and Purification Approaches:

    • Screen multiple detergents (DDM, LMNG, GDN) for optimal extraction

    • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs)

    • Affinity chromatography using engineered tags (His, FLAG)

    • Size exclusion chromatography for final purification and quality control

  • Stability Assessment:

    • Thermal stability assays (CPM, nanoDSF)

    • Activity assays to confirm proper folding

    • SEC-MALS to assess monodispersity and aggregation state

How might R33 serve as a target for antiviral development?

Given its important role in viral pathogenesis, R33 represents a potential target for antiviral strategies:

  • Target Validation Approaches:

    • Confirm the essential role of R33 in clinically relevant infection models

    • Identify specific functions of R33 that could be targeted (e.g., constitutive signaling, G protein coupling)

    • Determine whether inhibition of R33 after infection is established can alter disease course

  • Drug Discovery Strategies:

    • Structure-based design if structural data becomes available

    • High-throughput screening of compound libraries against R33 signaling

    • Repurposing of known GPCR modulators, particularly those targeting chemokine receptors

    • Development of antibodies or peptides targeting extracellular domains

  • Testing Paradigms:

    • In vitro signaling assays to identify initial hits

    • Cell-based viral replication assays to confirm antiviral activity

    • In vivo studies in the RCMV rat model to validate efficacy

  • Translational Potential:

    • Use findings from R33 studies to inform development of therapeutics targeting HCMV UL33

    • Consider combination approaches with existing antivirals

What are the emerging technologies that could advance R33 research?

Several emerging technologies hold promise for advancing R33 research:

  • Structural Biology Approaches:

    • Cryo-electron microscopy for membrane protein structures

    • X-ray free electron laser (XFEL) crystallography

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

  • Genomic and Gene Editing Tools:

    • CRISPR-Cas9 editing of viral genomes for precise mutation

    • Deep mutational scanning to comprehensively map functional residues

    • Viral BAC systems for more efficient recombinant virus generation

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to study receptor trafficking and localization

    • Intravital imaging to track infected cells in animal models

    • Bioluminescence resonance energy transfer (BRET) for real-time signaling studies

  • Systems Biology Approaches:

    • Proteomics to identify R33 interaction partners

    • Transcriptomics to understand downstream effects of R33 signaling

    • Computational modeling of R33 structure and dynamics

These technologies can provide new insights into R33 function and potentially reveal novel therapeutic approaches targeting this viral GPCR.

How can comparative studies between R33 and its homologs inform our understanding of viral GPCR evolution?

Comparative studies offer valuable insights into the evolution and function of viral GPCRs:

  • Evolutionary Analysis Approaches:

    • Phylogenetic analysis across betaherpesvirus GPCRs

    • Selection pressure analysis to identify conserved functional domains

    • Ancestral sequence reconstruction to understand evolutionary trajectories

  • Functional Complementation Studies:

    • Testing cross-species complementation (e.g., UL33 in RCMVΔR33)

    • Identifying species-specific vs. conserved functions

    • Creating chimeric receptors to map functional domains

  • Comparative Structural Analysis:

    • Homology modeling based on multiple viral GPCR sequences

    • Identification of conserved structural elements across viral GPCRs

    • Comparison with host GPCRs to understand viral mimicry

  • Host Range Considerations:

    • Correlation between viral GPCR functions and host species adaptations

    • Investigation of co-evolution between viral GPCRs and host signaling proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.