Recombinant Rat D (1A) dopamine receptor

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The rat D1A dopamine receptor is encoded by the Drd1 gene (UniProt: P18901) and features:

  • Molecular Weight: 49.4 kDa (predicted)

  • Domains: 7 transmembrane helices, extracellular N-terminus, intracellular C-terminus

  • Expression Systems: Commonly expressed in transfected LTK⁻ cells, HEK293 cells, and Sf-9 insect cells for functional studies

Research Applications

Recombinant D1A receptors are pivotal for:

  • Signal Transduction Studies: Activation of adenylyl cyclase via Gαs proteins, leading to cAMP production

  • Drug Screening: Testing agonist/antagonist efficacy (e.g., SCH23390 reduces cAMP by 40% in GRK5-overexpressing cells)

  • Disease Modeling: Investigating links to hypertension, ventricular hypertrophy, and neuropsychiatric disorders

Table 2: Experimental Models Using Recombinant D1A Receptors

Study TypeKey FindingsSource
GRK RegulationGRK2/3/5 differentially modulate receptor phosphorylation and cAMP responses
Cardiac ExpressionLocalized to coronary smooth muscle and ventricular myocytes; implicated in hypertrophy
Renal LocalizationExpressed in proximal/distal tubules and renal vasculature

Functional Insights

  • Adenylyl Cyclase Activation: SKF38393 (D1-like agonist) stimulates cAMP production in rat ventricular membranes (EC₅₀ = 10⁻⁷ M) .

  • Subcellular Localization: Found in plasma membranes, endoplasmic reticulum, and myosin filaments .

Pathophysiological Roles

  • Hypertension: Genetic variants correlate with ventricular hypertrophy in spontaneously hypertensive rats .

  • Neuropsychiatric Links: Altered DRD1A signaling is associated with addiction and schizophrenia in preclinical models .

Table 3: Pharmacological Profiles

ParameterValue/ObservationReference
EC₅₀ (Dopamine)0.3 μM (cAMP assay in HEK293 cells)
Detection Limit0.183 ng/mL (ELISA)
Antibody SpecificityValidated in transfected LTK⁻ cells and rat tissues

Technical Tools for Analysis

The Rat DRD1 ELISA Kit (Assay Genie RTEB0860) enables quantitative analysis with:

  • Sensitivity: 0.183 ng/mL

  • Dynamic Range: 0.312–20 ng/mL

  • Target Samples: Serum, plasma, tissue homogenates

Regulatory Mechanisms

  • GRK-Mediated Phosphorylation: GRK2/3 induce receptor desensitization, while GRK5 reduces maximal cAMP response by 40% .

  • Transcriptional Control: Brn-4 transcription factor enhances Drd1 expression via intronic enhancer elements .

Clinical Implications

  • Cardiovascular Therapy: Fenoldopam (D1-like agonist) improves cardiac output in hypertensive patients .

  • Renal Dysfunction: Altered DRD1A activity correlates with sodium retention in kidney disease models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Drd1; Drd1a; D(1A dopamine receptor; Dopamine D1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF FVISLAVSDLLVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDR YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL SVILDYDTDVSLEKIQPVTHSGQHST
Uniprot No.

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine.
Tissue Specificity
Brain, in the striatum, the nucleus accumbens, and the olfactory tubercle.

Q&A

What is the Rat D(1A) dopamine receptor?

The D(1A) dopamine receptor is a G protein-coupled receptor that mediates dopamine's physiological effects through activation of adenylyl cyclase . This receptor belongs to the D1-like receptor family and represents one of the major dopamine receptor subtypes expressed in both central nervous system and peripheral tissues. Its activity is primarily mediated through Gs protein coupling, leading to increased cAMP production and subsequent intracellular signaling cascades.

Where is the D(1A) dopamine receptor expressed in rats?

The D(1A) receptor shows tissue-specific expression patterns in rats. Studies have demonstrated its presence in:

  • Kidney: Localized to renal arterioles, juxtaglomerular apparatus, and both proximal and distal tubules

  • Heart: Distributed throughout the atrium and ventricular myocardium, including along cellular membranes of coronary smooth muscle cells and ventricular myocytes, as well as in myosin thick filaments and M-lines

  • Brain: Expressed in various regions, serving as the neurological control comparison for peripheral expression studies

How does the D(1A) receptor signal in cellular systems?

The D(1A) receptor primarily signals through G protein-coupled pathways, specifically activating adenylyl cyclase. Functional studies show that selective D1-like receptor agonists such as SKF38393 stimulate adenylyl cyclase in ventricular myocardial plasma membranes in a dose-related fashion, and this response can be abolished by selective D1-like receptor antagonists like SCH23390 . This signaling mechanism is conserved across various tissues expressing the receptor.

What techniques are optimal for detecting D(1A) receptor mRNA in rat tissues?

Several complementary approaches have proven effective for detecting D(1A) receptor mRNA:

  • RT-PCR: Particularly useful for microdissected tissue samples, as demonstrated in studies of proximal convoluted tubules of rat kidney

  • Self-sustained sequence replication (3SR): A novel transcription-based isothermal in situ amplification system that allows for detection of low-abundance mRNA directly within tissue sections

  • In situ hybridization: Traditional approach for brain tissue, though often insufficient for peripheral tissues due to lower receptor abundance

The choice of method depends on the research question, with RT-PCR offering high sensitivity for expression analysis, while 3SR provides spatial information about cellular localization.

How can researchers confirm D(1A) receptor protein expression?

Protein detection methods include:

  • Light microscopic immunohistochemistry: Using anti-peptide polyclonal antibodies directed toward amino acid sequences of the third extracellular and intracellular domains of the native receptor

  • Electron microscopic immunocytochemistry: Using the protein A gold method for subcellular localization

  • Western blot analysis: Revealing specific D(1A) bands with predicted size of 49 kDa (though observed band size may be 45 kDa)

  • ELISA: For quantitative measurement in serum, plasma, tissue homogenates, and other biological fluids

Validation typically involves multiple approaches to confirm specificity, such as using transfected cell lines as positive controls.

What controls are essential when studying D(1A) receptor expression?

Critical controls for D(1A) receptor studies include:

  • Positive controls: D(1A) receptor-transfected LTK− cells serve as validated expression systems

  • Negative controls: Non-transfected LTK− cells to demonstrate antibody specificity

  • Preimmune and preabsorption controls: Essential for validating immunohistochemical specificity

  • Brain tissue controls: As reference samples with known D(1A) receptor expression patterns

These controls help distinguish true receptor signals from experimental artifacts and confirm assay validity.

How should researchers design functional studies of the D(1A) receptor?

Functional studies should incorporate:

  • Dose-response relationships: Using selective agonists (e.g., SKF38393) at multiple concentrations

  • Antagonist competition: Including selective antagonists (e.g., SCH23390) to confirm receptor specificity

  • Downstream signaling measurements: Quantifying adenylyl cyclase activity, cAMP production, or other relevant signaling molecules

  • Time-course analyses: To capture receptor desensitization or internalization dynamics

These design elements help establish causality between receptor activation and observed physiological effects.

How can researchers differentiate between D(1A) and other dopamine receptor subtypes?

Distinguishing between dopamine receptor subtypes requires:

  • Subtype-selective antibodies: Directed toward unique epitopes of each receptor subtype

  • Pharmacological profiling: Using ligands with differential binding affinities across subtypes

  • Molecular approaches: Targeting unique nucleotide sequences specific to each receptor subtype

  • Functional assays: Measuring subtype-specific signaling mechanisms (e.g., adenylyl cyclase activation for D1-like receptors)

Research confirms that the D(1A) receptor mRNA and protein detected in peripheral tissues are homologous to those expressed in the brain .

What tissue-specific differences exist in D(1A) receptor expression and function?

Notable tissue-specific variations include:

  • Western blot differences: Specific D(1A) bands detected in transfected LTK− cells and atrium but not in non-transfected LTK− cells and ventricle

  • mRNA distribution patterns: D(1A) receptor mRNA predominantly localized in the kidney cortex

  • Co-localization patterns: D(1A) receptor mRNA and protein are colocalized in the same renal cells but may show differential distribution in other tissues

Understanding these differences is crucial for interpreting experimental results across different tissue systems.

What expression systems are optimal for recombinant Rat D(1A) receptor production?

Several expression systems have been validated:

  • LTK− cells: Successfully used for stable transfection and expression of functional D(1A) receptors

  • Selection considerations: Expression vectors should include appropriate promoters and selection markers

  • Validation approach: Receptor functionality must be verified through binding assays and downstream signaling activation

  • Protein extraction: Optimization of membrane protein isolation protocols is critical for maintaining receptor integrity

The choice of expression system impacts receptor folding, post-translational modifications, and functional characteristics.

How can researchers optimize purification of recombinant D(1A) receptor?

Purification strategies should consider:

  • Detergent selection: Critical for solubilizing membrane proteins without denaturing

  • Affinity approaches: Using receptor-specific ligands or antibodies for targeted isolation

  • Quality control: Verification of receptor integrity through binding assays

  • Functional preservation: Maintaining native conformation throughout the purification process

The predicted molecular weight of the D(1A) receptor is 49 kDa, though the observed band size in Western blots may be 45 kDa, potentially due to post-translational modifications or processing .

How should researchers interpret discrepancies between D(1A) receptor mRNA and protein detection?

When addressing discrepancies:

  • Tissue-specific expression: D(1A) receptor mRNA may be present in coronary vessels and myocardium in amplified but not in unamplified sections

  • Detection sensitivity: Standard techniques like Northern blot analysis and unamplified in situ hybridization may fail to detect peripheral D(1A) receptor mRNA due to low abundance

  • Methodological limitations: Consider differences in detection thresholds between protein and mRNA assays

  • Post-transcriptional regulation: Factor in potential mRNA stability and translational efficiency differences

These considerations help reconcile apparently contradictory findings across different experimental approaches.

What factors influence D(1A) receptor function in different experimental settings?

Key factors include:

  • Cellular context: Co-expression of interacting proteins such as calcyon and DNAJC14

  • Subcellular localization: D(1A) receptors may be found in cell membrane or endoplasmic reticulum membrane

  • Post-translational modifications: Affecting receptor trafficking, signaling efficiency, and ligand binding

  • Species differences: While conserved across species, subtle variations may impact pharmacological profiles

Understanding these factors helps explain variability in experimental outcomes and translational relevance.

How can researchers address challenges in detecting low-abundance D(1A) receptor mRNA?

Strategies include:

  • Amplification-based approaches: Using 3SR in situ permits elucidation of site-specific mRNA localization in a manner not possible with standard techniques

  • Primer design optimization: Targeting highly conserved regions to improve detection sensitivity

  • Sample preparation: Minimizing RNA degradation during tissue collection and processing

  • Quantitative methods: Employing digital PCR for absolute quantification of low-copy transcripts

These approaches have successfully demonstrated D(1A) receptor expression in tissues where traditional methods failed to detect it .

What strategies improve D(1A) receptor protein detection in complex tissue samples?

Optimization approaches include:

  • Signal amplification: Enhancing detection sensitivity for low-abundance proteins

  • Background reduction: Implementing stringent blocking protocols and optimizing antibody concentrations

  • Tissue preparation: Proper fixation and antigen retrieval techniques for immunohistochemistry

  • Antibody validation: Using multiple antibodies targeting different epitopes to confirm specificity

These strategies help overcome technical challenges in detecting native D(1A) receptor in complex tissue environments.

How do genetic modifications of the D(1A) receptor impact experimental outcomes?

Genetic approaches provide insights through:

  • Receptor tagging: Addition of epitope or fluorescent tags for enhanced detection

  • Site-directed mutagenesis: Identifying critical residues for ligand binding and signaling

  • Domain swapping: Determining regional contributions to receptor function

  • Knockout/knockin models: Evaluating physiological relevance through gene manipulation

These approaches complement pharmacological studies to provide mechanistic understanding of receptor function.

What emerging technologies are advancing D(1A) receptor research?

Cutting-edge approaches include:

  • Cryo-electron microscopy: For structural determination of the receptor in native-like environments

  • CRISPR-Cas9 genome editing: For precise manipulation of receptor expression

  • Optogenetics and chemogenetics: For temporal control of receptor signaling

  • Single-cell analysis: For understanding cellular heterogeneity in receptor expression and function

These technologies promise to resolve long-standing questions about D(1A) receptor biology and function in complex tissues.

MethodDetection SensitivityApplicationTissue ValidatedReference
RT-PCRHighmRNA detectionKidney, Heart
3SR in situHighLocalized mRNA detectionKidney
ImmunohistochemistryModerateProtein localizationKidney, Heart
Electron microscopyVery HighSubcellular localizationHeart
Western blotModerateProtein expressionBrain, Heart
ELISAHigh (0.183ng/mL)Quantitative detectionSerum, plasma, tissue homogenates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.