Recombinant Rat D (2) dopamine receptor (Drd2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat D (2) Dopamine Receptor

The D (2) dopamine receptor belongs to the G-protein coupled receptor family and plays fundamental roles in the central nervous system, mediating various physiological functions including locomotion, cognition, emotion, and neuroendocrine secretion . The rat variant of this receptor (Drd2) has become an important research tool due to its high homology with human D2 receptors and the prevalence of rat models in neuroscience research.

Recombinant Rat D (2) dopamine receptor refers specifically to the artificially expressed and purified form of this protein, produced through various expression systems including prokaryotic (E. coli), cell-free expression systems, and even eukaryotic systems like fission yeast . The availability of pure, well-characterized recombinant protein enables precise biochemical, structural, and pharmacological studies that would be challenging or impossible to perform in the complex environment of intact tissues or organisms.

The recombinant form maintains the key characteristics of the native receptor while offering advantages in terms of availability, purity, and consistency across experimental paradigms. This has significantly accelerated research into dopamine receptor function and related neurological disorders.

Gene Structure and Transcription

The rat D2 receptor gene exhibits a complex organization that provides insights into its evolutionary history and regulatory mechanisms. The gene spans at least 50 kilobases (kb) in the rat genome and contains eight exons, making it a relatively large and complex gene . This structure has been studied in comparative analyses with other dopamine receptor genes to understand their phylogenetic relationships.

One of the notable features of the rat D2 receptor gene is the presence of two independent transcription start sites. The primary site is positioned approximately 320 base pairs upstream from the 3' end of the first exon, while a secondary site is located an additional 70 base pairs further upstream . This dual-promoter arrangement is relatively uncommon and suggests sophisticated transcriptional regulation.

Both promoters lack the classical TATA box motif typically associated with transcription initiation, yet they remain functional. Transient expression assays using fusion constructs combining D2-promoter fragments with luciferase reporter genes have confirmed that each promoter can independently drive transcription. Interestingly, when both promoters function together, transcription is significantly enhanced, suggesting a synergistic mechanism .

Alternative Splicing and Isoforms

The rat D2 receptor exists in at least two major isoforms due to alternative splicing: D2-short and D2-long. These isoforms differ in their third intracellular loop, which is involved in G-protein coupling. The recombinant forms of these isoforms have been produced for comparative studies of their functional properties .

coli Expression System

The bacterial expression of Recombinant Rat D (2) dopamine receptor in E. coli represents one of the most common production methods due to its relative simplicity, cost-effectiveness, and high yield. According to available information, this approach typically yields recombinant protein with purity levels ranging from 90% to greater than 95% as determined by SDS-PAGE analysis .

The E. coli-expressed protein is commonly used for applications including positive control, immunogen production, SDS-PAGE analysis, and Western blot applications . This expression system is particularly advantageous for producing protein fragments or domains rather than the full-length receptor, as membrane proteins can be challenging to express properly in prokaryotic systems.

Cell-Free Expression System

Cell-free expression systems offer significant advantages for the production of membrane proteins like dopamine receptors. This approach circumvents many of the challenges associated with expressing membrane proteins in cellular systems, such as toxicity or improper folding.

The recombinant rat D2 receptor produced through cell-free expression systems typically achieves purity levels of 85% or higher as determined by SDS-PAGE . These preparations are particularly valuable for structural studies and applications where native-like conformation is essential.

Fission Yeast Expression System

A more specialized approach involves expressing the rat D2(long) dopamine receptor in the fission yeast Schizosaccharomyces pombe. This eukaryotic system has been documented to produce the receptor at levels of approximately 1 pmol/mg of protein . The advantage of this system lies in its eukaryotic cellular machinery, which can facilitate proper protein folding and post-translational modifications that may be essential for certain receptor functions.

The recombinant receptor expressed in fission yeast exhibits pharmacological properties typical of a D2 dopamine receptor, making it suitable for ligand binding studies and other functional analyses . This system represents an important compromise between the simplicity of prokaryotic expression and the authenticity of mammalian expression systems.

Protein Nomenclature and Identification

The recombinant rat D2 dopamine receptor is identified by several alternative names in the scientific literature and commercial products:

  • D(2) dopamine receptor

  • Dopamine receptor D2

  • DR-D2

  • D2DR

  • D2R

This variety in nomenclature reflects both historical naming conventions and the identification of specific isoforms. The gene encoding this receptor is commonly designated as Drd2 in the rat genome .

Purity and Quality Assessment

The quality of recombinant rat D2 receptor preparations is typically assessed through SDS-PAGE analysis, with most commercial and research-grade preparations achieving purity levels between 85% and 95% . The specific purity level depends on the expression system and purification methods employed.

For cell-free expression systems, the standard purity threshold is approximately 85%, while E. coli-based systems can achieve greater than 90-95% purity through optimized purification protocols . These high-purity preparations are essential for applications requiring minimal contamination, such as structural studies, antibody production, and pharmacological characterization.

ELISA-Based Detection Systems

Enzyme-Linked Immunosorbent Assay (ELISA) represents one of the most precise and widely used methods for quantifying rat D2 dopamine receptor in various biological samples. Commercial ELISA kits have been developed specifically for this purpose, with impressive sensitivity and reproducibility profiles.

A typical rat DRD2 ELISA kit exhibits a sensitivity of 0.121 ng/mL and a detection range spanning from 0.32 to 20 ng/mL. These kits employ the sandwich ELISA principle, utilizing a combination of capture antibodies pre-coated on microtiter plates and biotin-conjugated detection antibodies specific to rat DRD2 .

The standard curve for a representative rat DRD2 ELISA kit demonstrates excellent linearity across the detection range, as illustrated in the following data:

Concentration (ng/mL)ODCorrected OD
20.002.0541.961
10.001.6451.552
5.001.2671.174
2.500.9330.840
1.250.5160.423
0.630.3310.238
0.320.1560.063
0.000.0930.000

These kits demonstrate excellent precision, with intra-assay coefficient of variation (CV) less than 8% and inter-assay CV less than 10%, indicating high reproducibility both within and between experimental runs .

The recovery rates for various biological matrices have been validated:

  • Serum: 78-90% (average 84%)

  • EDTA plasma: 84-97% (average 90%)

  • Heparin plasma: 87-95% (average 91%)

These recovery rates confirm the reliability of these assays for quantifying the recombinant receptor in different sample types, including tissue homogenates, cell lysates, and various biological fluids.

In Situ Hybridization Techniques

In situ hybridization represents another valuable technique for studying the expression of D2 receptor mRNA in rat brain tissues. This approach utilizes radioactively labeled riboprobes transcribed from D2 receptor cDNA to visualize and quantify receptor expression at the cellular level .

Quantitative analysis of the hybridization signals, measured as silver grain counts per cell, provides precise information about the level of receptor mRNA expression in specific brain regions. This technique has been particularly valuable for studying changes in receptor expression under different physiological conditions .

Ligand Binding Characteristics

The recombinant rat D2 dopamine receptor exhibits pharmacological properties consistent with the native receptor, making it an excellent tool for drug discovery and characterization studies. Ligand binding experiments using the receptor expressed in fission yeast have demonstrated binding profiles typical of a D2 dopamine receptor .

The affinities of antagonists generally align with values obtained for the receptor expressed in mammalian systems, although some differences have been observed. Specifically, the affinities of certain antagonists are lower when measured with the recombinant receptor compared to the native receptor in mammalian tissues .

Modulation by Ions and Nucleotides

An interesting pharmacological property of the recombinant rat D2 receptor is the differential sensitivity of antagonist binding to sodium ions. Substituted benzamide antagonists exhibit lower binding affinities in the absence of sodium ions, whereas clozapine and classical antagonists generally show higher affinities under the same conditions .

Notably, agonist binding to the recombinant receptor expressed in fission yeast appears to be insensitive to the effects of guanosine triphosphate (GTP). This observation suggests a lack of stable interaction with G-proteins in this expression system, which differs from the behavior of the native receptor in mammalian systems . This characteristic must be considered when using the recombinant receptor for screening potential agonists.

Expression Patterns in the Rat Brain

The D2 dopamine receptor shows region-specific expression patterns in the rat brain, with the highest levels observed in the caudate putamen (striatum) . This brain region is heavily involved in motor control and reward processing, consistent with the known functions of dopamine signaling.

Hormonal Regulation of Expression

Studies using quantitative in situ hybridization have revealed that the expression of D2 receptor mRNA in the rat brain varies significantly during different physiological states. In female rats, for example, the expression levels fluctuate during different stages of the estrous cycle .

The expression of D2 receptor mRNA in the lateral striatum reaches its peak during dioestrus 2 (DOE2). Interestingly, the number of cells expressing the D2 receptor mRNA also changes across cycle phases, with the highest number detected during estrus (OE) . These findings suggest that variations in D2 receptor mRNA concentration result from both changes in the expression level per cell and alterations in the number of cells expressing the receptor.

In the anterior pituitary gland, D2 receptor mRNA expression follows a different pattern, with the lowest levels during estrus, increasing during dioestrus 1, peaking in dioestrus 2, and then declining again in proestrus . This pattern suggests complex hormonal regulation of receptor expression in different brain regions.

Immunological Applications

The recombinant rat D2 dopamine receptor serves as a valuable tool for various immunological applications. It can function as a positive control for antibody validation, an immunogen for antibody production, and a target antigen for techniques including Western blot, ELISA, and immunoprecipitation .

The high purity of recombinant preparations ensures specificity in these applications, reducing the risk of cross-reactivity with other proteins that might be present in less purified samples from native tissues.

Pharmacological Screening

One of the most significant applications of recombinant rat D2 dopamine receptor is in drug discovery and pharmacological screening programs. The purified receptor provides a controlled system for evaluating the binding properties of potential therapeutic compounds targeting dopamine signaling pathways .

Drug screening assays using the recombinant receptor can identify compounds with specific affinities for the D2 receptor, helping to predict their potential efficacy and selectivity before advancing to more complex in vivo testing. This approach accelerates the drug discovery process while reducing the need for animal testing in early screening phases.

Structure-Function Studies

The availability of purified recombinant rat D2 dopamine receptor has facilitated detailed structure-function studies that illuminate the molecular mechanisms underlying receptor activation, signaling, and regulation. These studies contribute to our fundamental understanding of G-protein coupled receptor biology while potentially revealing novel therapeutic approaches for conditions involving dopamine signaling dysregulation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributors for precise delivery estimates.
Note: All our proteins are standardly shipped with normal blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20℃/-80℃. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Drd2; D(2 dopamine receptor; Dopamine D2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFMKILHC
Uniprot No.

Target Background

Function
This dopamine receptor's activity is regulated by G proteins, which inhibit adenylyl cyclase. It plays a role in regulating the postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity, downstream of OPN5.
Gene References Into Functions
  1. Studies indicate that D2 receptors modulate [(3)H]GABA release at striatopallidal terminals by activating the PLC-->IP3-->Calcineurin-signaling cascade, which is the same pathway involved in regulating soma excitability. Moreover, D2 receptors inhibit release when AC is active. Both mechanisms converge to regulate the activity of presynaptic L-type Ca(2+) channels. PMID: 29292080
  2. D2R knockdown in neurons with cell bodies in the ventral tegmental area (VTA) shifted the discounting curve to the left, indicating a preference for smaller, immediate rewards, while the curve for control rats remained stable. These results demonstrate that a reduction in VTA D2Rs enhances impulsivity in choice behavior. PMID: 29287910
  3. More than half of parvalbumin neurons co-express high levels of the alpha7 subunit of the nicotinic acetylcholine receptor and/or the D2-subtype of the dopamine receptor. PMID: 28834708
  4. The colocalization of the kappa opioid receptor and D2R both pre- and postsynaptically supports a role for the kappa opioid receptor in potentiating both the D2R inhibitory autoreceptor function and the inhibitory action of D2R on efferent medium spiny neurons. Co-activation of the kappa opioid receptor accelerates D2R sensitization by contributing to decreased dopamine release in the nucleus accumbens. PMID: 28531297
  5. Dopamine D2 receptor antagonism differentially affects aversive memory formation after acute or long-term sugar consumption. These findings demonstrate that nucleus accumbens dopamine D2 receptors exhibit distinct functions during conditioned taste aversion depending on the level of sugar familiarity. PMID: 28716589
  6. The prefrontal expression of distinct D2 dopamine receptor splice variants is hypothesized to be implicated in cognitive decline resulting from early life immune challenges. PMID: 28673768
  7. This study investigated the effects of D2 receptor activation and inhibition on the anxiogenic response to cocaine using a runway model of self-administration sensitive to the dual and opposing effects of the drug. The findings demonstrate that D2 receptor activity in the lateral habenula modulates the anxiogenic response to cocaine. PMID: 27155504
  8. This study provided pharmacological evidence supporting the notion that activation of ventral pallidum D2 dopamine receptors enhances memory consolidation and the long-term stability of the formed memory in inhibitory avoidance learning. PMID: 28057528
  9. The data provides evidence for the crucial role of ventral pallidum D2 dopamine receptors in the consolidation and stabilization of spatial memory. PMID: 27392640
  10. Transient activation of mGluRs decreased the GIRK current evoked by GABAB and D2 receptors, although the effect was less pronounced for D2. PMID: 28009293
  11. These results demonstrate that a junk food diet-induced obesity reduces ethanol drinking, suggesting that increased D2R autoinhibition in the VTA might contribute to deficits in DAergic signaling and reward hypofunction observed in obesity. PMID: 28859110
  12. Fetal alcohol exposure increased the expression levels of miR-9, reduced levels of D2r, and increased levels of Prl in the pituitary and plasma. PMID: 28710248
  13. The present study suggested that amphetamine-induced circling behavior indicated striatal dopaminergic alterations, and that dopamine transporter and dopamine D2 receptor binding could be key markers for predicting motor dysfunction after mild focal ischemia. PMID: 26911894
  14. Results suggest that adolescents might be more susceptible to relapse due to a deficit in cue extinction learning, highlighting the significance of D2R signaling in the infralimbic cortex for cue extinction during adolescence. PMID: 26946126
  15. The data demonstrate an association between the anxious behavior of rats with A2/A2 genotype by DRD2 locus Taq 1A and the structural organization of the cerebral basolateral nucleus of the amygdaloid complex in WAG/Rij rats with polymorphic variants of this locus. PMID: 27878728
  16. Significant differences in the effect of neonatal lesion in the ventral hippocampus on drd2 and drd3 mRNA expression levels were observed among the brain regions analyzed in adult rats. These findings suggest that the expression levels of some dopamine receptors might be regulated during adulthood, leading to behavioral and neurochemical changes associated with schizophrenia. PMID: 28096775
  17. Avoidance stress induced visceral hyposensitivity through peripheral CRF receptor type 2 and central dopamine D2 receptor, but not through opioid pathways. PMID: 26662216
  18. The CaMKIIalpha-calmodulin complex alters the affinity of dopamine (DA)-D2R, causing DA to dissociate and bind with calmodulin. PMID: 26446938
  19. Results indicate that D2Rs inhibit SFK (primarily Fyn) phosphorylation in the striatum. PMID: 26777117
  20. D2DR expression in the ventral striatum also negatively correlated with impulsive responding, independent of diet. PMID: 26527415
  21. The role of DRD2-CaMKIIalpha signaling is functionally reversed within the basolateral amygdala-medial prefrontal cortex pathway depending on the state of opiate exposure. PMID: 26174594
  22. Findings suggest that dopamine, acting through D2 receptors in the deep layers of the superior colliculus and dorsal periaqueductal gray, is involved in defense reactions organized in the midbrain tectum. PMID: 26455877
  23. The D2R is primarily distributed in glomus cells in the rat carotid body, suggesting that D2R plays a role in the inhibitory modulation of chemosensory activity in a paracrine and/or autocrine manner. PMID: 26272445
  24. Results link reduced expression of both the D2R and Wntless to the explicit motivation for heroin rather than to differences in total drug intake per se. PMID: 26501177
  25. Stress exposure induces a hypodopaminergic state accompanied by increased mRNA levels of the dopamine receptor type 2 (Drd2) in the orbitofrontal cortex. PMID: 26233608
  26. This study provides evidence of expression of a catecholamine receptor, D2-like immunoreactivity, in the rat nucleus incertus. PMID: 26300469
  27. Fetal alcohol-exposed rats exhibited increased levels of pituitary weight, prolactin protein and mRNA, and plasma PRL, along with decreased pituitary levels of dopamine D2 receptor (D2R) mRNA and protein and increased pituitary levels of D2R promoter methylation. PMID: 26509893
  28. The dopamine D2 receptor plays a significant role in the retrieval process of pre-exposure learning. PMID: 26345345
  29. Findings show that D2-like dopamine receptors in the ventral tegmental area and nucleus accumbens play a crucial role in the lateral hypothalamus-mediated modulation of nociceptive information in the acute pain model in rats. PMID: 26166189
  30. Results suggested that maternal stress can permanently alter the offspring's addictive behavior and D2 receptors' expression. PMID: 26192093
  31. This study demonstrated that VTA D2R knockdown results in increased incentive motivation but does not directly promote other aspects of addiction-like behavior. PMID: 25735756
  32. Individual differences in risk preference, as well as real-time risky decision-making, can be largely explained by the encoding in dopamine receptor type-2-expressing nucleus accumbens cells of prior unfavorable outcomes during decision-making. PMID: 27007845
  33. Early life stress enhanced susceptibility to late-life stress and resistance to escitalopram treatment by decreasing microRNA-9 expression and subsequently upregulating dopamine receptor D2 expression in the nucleus accumbens. PMID: 25740916
  34. Data suggest important but dissociable roles of dopamine D1 and D2 receptors in impulse control. The preference for delayed rewards depends on D1 receptors, whereas acute cocaine inhibited impulsive choice by activating D2 receptors in the basolateral amygdala. PMID: 25823760
  35. Increased expression of RAGE may play a role in the pathogenesis of PH in nitrofen-induced CDH. PMID: 25783380
  36. Dopamine deficiency induces compensatory activation of tyrosine hydroxylase via phosphorylation at 40Ser through D2-autoreceptor and PKA-mediated pathways. PMID: 26225746
  37. This study demonstrated that reduced striatal D2 might be related to individual vulnerability to stress-induced reinstatement of heroin-seeking. PMID: 25446223
  38. These results suggest that D2R activation induces a Gbetagamma- and extracellular signal-regulated kinase 1/2-dependent increase in the level of Zif268, which functions to directly up-regulate the expression of GDNF. PMID: 23373701
  39. Results suggest that stress-induced activation of medial prefrontal cortex D2 receptors during adolescence promotes subsequent reductions in dopamine activity. PMID: 24271009
  40. Given the dose-dependent inhibitory effect of D2-ags on ovarian VEGF production reported herein, we infer that current OHSS therapies used in humans could be improved by increasing the intraovarian concentration of D2-ags in these patients. PMID: 25217874
  41. In PC-12 cells, released dopamine triggers a delayed Ca2 + release via a dopamine receptor D2. PMID: 24055909
  42. It may play a significant role in modulating oxidative stress and inflammation in the substantia nigra and striatum via the RAS, which is impaired by aging. PMID: 24529758
  43. Suppressive effect of perifornical lateral hypothalamus D2 receptor on EtOH drinking. PMID: 24236888
  44. Results show that DA receptor inactivation causes dramatically different behavioral effects in preweanling and adult rats, providing further evidence that the D2 receptor system is not functionally mature by the end of the preweanling period. PMID: 24057816
  45. Dopamine D2 receptor expression is decreased in the brainstem of animals fed high-fat high-sugar diets. PMID: 24262750
  46. We conclude that a diurnal change in D2R mRNA expression in MBH might underlie the diurnal rhythms of TIDA neuron activity and PRL secretion in OVX+E2 rats. PMID: 24884386
  47. DDR2 binding and activation were disrupted by collagen glycation, pointing to a mechanism for the diminished levels of lysyl oxidase and consequently low lysyl oxidase-derived cross-links in diabetic bone. PMID: 24120383
  48. The time course of Drd2- and noradrenaline receptor-mediated transmission reflects underlying differences in the extent of spillover and pooling of inhibitory postsynaptic potentials (IPSPs). PMID: 24872568
  49. Individual differences in D2 dopamine receptor sensitivity might be predictive of cocaine sensitivity and reward. PMID: 24223783
  50. The cardiac sympathoinhibition induced by 3 mug kg(-1) min(-1) quinpirole involves the dopamine D2 receptor subtype. PMID: 24032529

Show More

Hide All

Database Links

KEGG: rno:24318

UniGene: Rn.87299

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
[Isoform Long]: Expressed in the anterior lobe of the pituitary gland. Expressed ventral tegmental area of the midbrain and the pars compacta of the substantia nigra. Expressed seven times more than isoform short in the caudate nucleus.; [Isoform Short]:

Q&A

What are the main isoforms of the rat D(2) dopamine receptor and how do they differ structurally?

The rat D(2) dopamine receptor exists in two main isoforms: D2 short (D2S) and D2 long (D2L), which are products of alternative splicing. The D2L isoform is characterized by the insertion of 29 amino acids in the third cytoplasmic loop, which is absent in the D2S isoform . This structural difference results in distinct molecular weights that can be identified using Western blot analysis, with D2S and D2L immunoreacting to 47- and 59-kDa proteins, respectively . The differential structure of these isoforms is believed to underlie their distinct functional roles in dopaminergic signaling and their interaction with different downstream signaling partners.

What is the anatomical distribution of Drd2 isoforms in the rat brain?

The D2S and D2L receptor isoforms show remarkable compartmentalization in the brain. The D2S isoform predominates in the cell bodies and projection axons of dopaminergic cell groups in the mesencephalon and hypothalamus . In contrast, the D2L isoform is more strongly expressed by neurons in the striatum and nucleus accumbens, which are structures targeted by dopaminergic fibers .

Within the anterior cingulate cortex (ACC), a specific pattern of Drd2 expression has been observed. Very few Drd2-positive cells are found in layer 1, with more Drd2-positive cells distributed in layer 5 than in layers 2-3 . All Drd2-positive cells are neurons, with approximately 45% of neurons in layer 5 expressing Drd2, and about 10% of Drd2-positive neurons being GABAergic interneurons .

How can researchers distinguish between D2S and D2L isoforms in experimental settings?

Researchers can employ subtype-specific antibodies against both D2S and D2L isoforms to differentiate between them. These antibodies have been validated through Western blot analysis using tissue membranes and dopamine receptor cDNA-transfected recombinant cell lines . When testing specificity, the antibodies should show no cross-reactivity between D2S and D2L and no reactivity with other dopamine receptor subtypes .

For quantitative analysis, immunoprecipitation techniques can be used to measure the relative abundance of each isoform. In studies using D2 receptor antagonists like [³H]spiperone and [³H]YM-09151, it was demonstrated that in substantia nigra and cerebral cortex, the D2S receptor is about 28% more abundant than D2L, whereas in the striatum both isoforms exist in similar quantities .

What role does Drd2 play in cortical synaptic pruning and how is this regulated?

The regulatory mechanism involves mTOR signaling. Downregulation of Drd2 leads to activation of the AKT-mTOR pathway, as demonstrated by increased protein levels of p-AKT, p-mTOR, and p-S6 ribosomal protein in the ACC from SR-Drd2+/− rats . This connection was further validated through rapamycin (an mTOR inhibitor) treatment experiments, which rescued the spine density phenotype in SR-Drd2+/− rats by reducing spine densities and mEPSC frequency to control levels .

How can researchers develop and validate genetic models for studying Drd2 function?

To study Drd2 function, researchers have developed various genetic models. The self-reporting Drd2 heterozygous (SR-Drd2+/−) rat model enables simultaneous visualization of Drd2-positive neurons and downregulation of Drd2 expression . This model is created by crossing Drd2-Cre rats with Cre-dependent tdTomato reporter (Ai14) rats to generate SR-Drd2 rats, followed by crossing SR-Drd2 rats with Drd2+/− rats .

For cell-specific studies, viral vectors can be used to create localized knockdown models. For example, adeno-associated virus (AAV) expressing Cre-dependent Drd2 shRNA and EGFP can be injected into specific brain regions of Drd2-Cre rats to downregulate Drd2 expression only in Cre-expressing cells .

What electrophysiological methods can be used to assess functional consequences of altered Drd2 expression?

Whole-cell patch-clamp recordings provide valuable insights into the functional consequences of altered Drd2 expression. For excitatory synaptic transmission analysis, researchers can measure miniature excitatory postsynaptic currents (mEPSCs), examining both frequency and amplitude . In SR-Drd2+/− rats, the frequency but not amplitude of mEPSCs was higher in Drd2-positive neurons starting from 5 weeks of age, correlating with the observed increase in dendritic spine density .

For inhibitory synaptic transmission, miniature inhibitory postsynaptic currents (mIPSCs) can be recorded. Interestingly, neither the frequency nor amplitude of mIPSCs was altered in Drd2-positive neurons from SR-Drd2+/− rats, suggesting that Drd2 reduction specifically affects excitatory but not inhibitory synapses .

To assess cell-intrinsic excitability, researchers can perform current-clamp recordings with direct depolarizing current injections to generate input-output curves of action potentials. Drd2-positive neurons from SR-Drd2+/− rats showed an upward shift in input-output curves, indicating enhanced excitability . This comprehensive electrophysiological profile helps establish the functional correlates of structural changes observed in dendritic spines.

How should researchers design time-course studies to investigate Drd2-mediated synaptic development?

Time-course studies are essential for distinguishing between effects on synapse formation versus pruning. For rat models, critical developmental windows include:

  • 3-4 weeks: Baseline assessment before major pruning occurs

  • 4-5 weeks: Early pruning phase

  • 5-8 weeks: Active pruning period

  • 8+ weeks: Adult stage after pruning completion

At each timepoint, researchers should examine:

  • Dendritic spine density using fluorescent microscopy of labeled neurons

  • Spine morphology classification (mushroom-like, stubby, thin)

  • Electrophysiological properties through patch-clamp recordings

  • Protein expression levels via Western blot analysis

In control animals, spine densities should decrease during the pruning phase (4-8 weeks), while in Drd2-deficient models, this reduction would be impaired . By analyzing both structural and functional parameters across this developmental timeline, researchers can determine whether Drd2 affects initial synapse formation, subsequent pruning, or both processes.

What approaches can be used to determine cell-autonomous versus non-cell-autonomous effects of Drd2?

To distinguish between cell-autonomous and non-cell-autonomous effects, researchers can employ several complementary approaches:

  • Global versus selective knockdown: Compare phenotypes between global Drd2 reduction (SR-Drd2+/− rats) and cell-specific knockdown using viral vectors (Cre-dependent Drd2 shRNA in Drd2-Cre rats) . Similar phenotypes in both models suggest cell-autonomous mechanisms.

  • Mosaic analysis: Use sparse labeling techniques to examine Drd2-deficient neurons surrounded by wild-type neurons. If the phenotype persists in isolated Drd2-deficient neurons, this supports cell-autonomous mechanisms.

  • Conditional expression: Implement temporal control of Drd2 knockdown/rescue using inducible systems to determine if the timing of Drd2 restoration affects the phenotype.

  • Co-culture experiments: Culture neurons with different Drd2 expression levels together to assess whether wild-type neurons can rescue the phenotype of Drd2-deficient neurons (suggesting non-cell-autonomous effects).

Evidence from viral-mediated knockdown experiments has demonstrated that selective reduction of Drd2 in ACC neurons is sufficient to increase spine density and mEPSC frequency, strongly supporting a cell-autonomous mechanism for Drd2-mediated synaptic pruning .

How does Drd2 interact with the mTOR signaling pathway to regulate synaptic pruning?

Drd2 regulates synaptic pruning through modulation of the AKT-mTOR signaling pathway. Downregulation of Drd2 leads to activation of this pathway, as evidenced by:

  • Increased phosphorylation of AKT in SR-Drd2+/− rats

  • Elevated levels of phosphorylated mTOR

  • Enhanced phosphorylation of S6 ribosomal protein, a downstream target of mTOR

This signaling cascade is functionally relevant, as demonstrated by rapamycin treatment experiments. Daily microinjection of rapamycin (an mTOR inhibitor) into deep layers of ACC from 3-8 weeks of age effectively prevented the increase in spine density and mEPSC frequency in SR-Drd2+/− rats, normalizing these parameters to control levels . This rescue effect specifically targeted the Drd2+/− phenotype, as rapamycin did not affect spine densities in control rats.

The connection between Drd2 and mTOR signaling is particularly significant because mTOR dysregulation has been implicated in various neurodevelopmental disorders, including autism spectrum disorders that often exhibit deficient synaptic pruning .

What are the functional differences between D2S and D2L isoforms in neural signaling?

The D2S and D2L isoforms exhibit distinct functional roles based on their differential expression patterns. The strategic localization of D2S in dopaminergic cell bodies and axons strongly suggests that this isoform functions as the dopamine autoreceptor, regulating dopamine synthesis and release through negative feedback mechanisms . In contrast, D2L is predominantly expressed in postsynaptic neurons in striatum and nucleus accumbens, positioning it as the primary postsynaptic receptor mediating dopamine's effects on target neurons .

This functional distinction is critical for understanding dopaminergic transmission and has significant implications for interpreting the effects of drugs targeting D2 receptors. Most antipsychotic medications do not discriminate between D2S and D2L, potentially explaining why they can affect both presynaptic and postsynaptic dopamine functions. Future drug development might benefit from isoform-specific targeting to separately modulate autoreceptor versus postsynaptic functions .

The structural basis for these functional differences likely involves the additional 29 amino acids in the third cytoplasmic loop of D2L, which may enable differential coupling to G-proteins or interaction with distinct intracellular signaling partners .

How do deficits in Drd2-mediated synaptic pruning affect adult brain function and behavior?

Deficits in Drd2-mediated synaptic pruning during adolescence lead to persistent changes in adult brain function and behavior. Studies of SR-Drd2+/− rats have revealed:

  • Hyper-glutamatergic function in the ACC, as evidenced by increased mEPSC frequency and enhanced cellular excitability

  • Development of anxiety-like behaviors in adulthood, suggesting that proper synaptic pruning during development is essential for normal emotional regulation

This connection between developmental pruning deficits and adult anxiety behaviors establishes a mechanistic link between early synaptic development and later behavioral outcomes. The ACC is implicated in emotional processing, particularly anxiety and depression, making alterations in this region particularly relevant for understanding the developmental origins of psychiatric symptoms .

The finding that rapamycin treatment during adolescence can prevent both the synaptic and behavioral phenotypes suggests a potential therapeutic window during which intervention might prevent long-term consequences of pruning deficits . This emphasizes the importance of the developmental timing of Drd2 function for establishing proper neural circuits.

What are the implications of D2S versus D2L expression patterns for dopaminergic transmission in health and disease?

The differential expression patterns of D2S and D2L have profound implications for dopaminergic transmission and its dysregulation in disease. The predominance of D2S in dopaminergic neurons suggests it serves as the primary autoreceptor regulating dopamine release . This makes D2S a potential target for conditions involving dysregulated dopamine release, such as:

  • Schizophrenia, where excessive dopamine release may contribute to positive symptoms

  • Parkinson's disease, where enhancing dopamine availability through autoreceptor modulation could be therapeutic

  • Substance use disorders, where drug-induced alterations in autoreceptor function may contribute to addiction

Conversely, the predominance of D2L in postsynaptic neurons in striatum and nucleus accumbens positions it as the primary mediator of dopamine's effects on motor control, reward processing, and motivated behavior . Dysregulation of D2L function may contribute to:

  • Movement disorders, including tardive dyskinesia and Parkinson's disease

  • Reward processing deficits in addiction and depression

  • Motivational disturbances in various psychiatric conditions

Understanding the distinct contributions of these isoforms enables more nuanced interpretations of dopaminergic dysfunction in neuropsychiatric disorders and may guide the development of more targeted therapeutic approaches.

What immunohistochemical approaches can be used to visualize and quantify Drd2 isoforms in brain tissue?

For accurate visualization and quantification of Drd2 isoforms in brain tissue, researchers can employ several sophisticated immunohistochemical techniques:

  • Isoform-specific antibodies: Utilize antibodies that specifically recognize D2S or D2L without cross-reactivity. These should be validated using recombinant cell lines expressing either isoform exclusively .

  • Double-labeling with neuronal markers: Combine Drd2 isoform labeling with markers such as NeuN (for neurons) or GAD67 (for GABAergic interneurons) to characterize the cellular identity of Drd2-expressing cells .

  • Electron microscopic analysis: For subcellular localization, double-labeling electron microscopy can be performed using immunogold for receptor isoforms and immunoperoxidase for dopaminergic markers such as tyrosine hydroxylase (TH) or dopamine transporter (DAT) .

  • Quantitative analysis: For each cortical layer, calculate the percentage of Drd2-positive cells among total neurons and the percentage of specific neuronal subtypes expressing Drd2. This can be done through stereological counting methods and confocal microscopy for accurate co-localization assessment .

  • Transgenic reporter approaches: Use Cre-dependent fluorescent reporter systems crossed with Drd2-Cre lines to visualize Drd2-expressing neurons. This approach can be validated using viral injection of Cre-dependent reporter viruses in adult animals to rule out developmental artifacts .

How can researchers accurately quantify changes in dendritic spine density and morphology in Drd2 studies?

Accurate quantification of dendritic spine changes requires systematic approaches:

  • Sampling strategy: Analyze secondary and tertiary dendritic branches from pyramidal neurons in specific cortical layers. For ACC studies, focus on layer 5 where Drd2 expression is highest .

  • Spine classification: Categorize spines into morphological subtypes (mushroom-like, stubby, thin) based on standardized criteria. Mushroom-like spines typically represent mature synapses, while stubby spines may indicate ongoing spinogenesis .

  • Confocal microscopy parameters: Use high-resolution confocal microscopy with appropriate z-stack intervals (typically 0.2-0.5 μm) to capture the three-dimensional structure of dendrites and spines.

  • Analysis software: Employ specialized software (e.g., Neurolucida, Imaris) for semi-automated or manual spine counting and classification. Ensure blinded analysis to prevent observer bias.

  • Standardized reporting: Present data as spine density per unit length of dendrite (typically per 10 μm), with separate analyses for different spine morphologies and dendritic compartments.

In Drd2 studies, researchers should examine multiple age points (e.g., 4, 5, 6, and 8 weeks) to capture the dynamic process of spine pruning during development . Comparison between control and experimental groups should include both total spine density and the density of specific spine subtypes to detect selective effects on spine maturation or elimination.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.