Recombinant Rat D (3) dopamine receptor (Drd3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Drd3; D(3 dopamine receptor; Dopamine D3 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNVEFRKAFLKILSC
Uniprot No.

Target Background

Function
This dopamine receptor's activity is mediated by G proteins that inhibit adenylyl cyclase. It also promotes cell proliferation.
Gene References Into Functions

Functional Studies of the Rat Dopamine D3 Receptor (DRD3):

  1. BDNF regulates the dopamine system by influencing DRD3 and DAT. PMID: 28598964
  2. The renal D3 receptor modulates D4 receptor expression and function in renal proximal tubule cells via the PLC/PKC signaling pathway. PMID: 27254310
  3. Neonatal ventral hippocampal lesions differentially impact Drd2 and Drd3 mRNA expression in adulthood, suggesting adult regulation of dopamine receptor expression influencing behavior and neurochemistry relevant to schizophrenia. PMID: 28096775
  4. D3 and D1-D3 receptor heteromers increase in 6-OHDA-lesioned rats rendered dyskinetic by L-DOPA, equally sensitizing striatal D1 receptors to dopamine. PMID: 25344317
  5. Chronic stress-induced risk aversion correlates with reduced orbitofrontal cortex dopamine levels, reversible by DRD2/DRD3 agonists. PMID: 26233608
  6. Let-7d represses DRD3 transcriptionally through DNMT-dependent DNA methylation and histone modification. PMID: 26802971
  7. DRD3, in combination with angiotensin II type 2 receptors, enhances natriuresis and diuresis via the ERK1/2-MAPK pathway. PMID: 25770092
  8. Significant associations exist between disordered gambling and rs167771 (DRD3) and rs381572 (CAMK2D), supported by animal studies. PMID: 25266122
  9. Dopamine D3 signaling is crucial for adolescent nicotine sensitization, suggesting it as a prevention target for nicotine dependence. PMID: 25907750
  10. D3R activation protects against renal I/R injury by decreasing Galpha12-induced damage. PMID: 25989500
  11. Dopamine denervation alters D3R signaling and CaMKII control in nigral projections of medium spiny neurons. PMID: 25517101
  12. The D3 dopamine receptor is essential in the reinforcing effects of alcohol. PMID: 25257287
  13. Dopamine D3 (and D2) availability inversely correlates with baseline D2/3 receptor availability in the ventral striatum of high-impulsive rats. PMID: 23399948
  14. Impulsivity and hyperactivity are differentially regulated by nucleus accumbens sub-regions, with high-impulsive rats showing enhanced responses to D2/3 receptor activation. PMID: 23407782
  15. Dopamine D3 receptors predominantly mediate the inhibition of quinpirole-induced vasopressor sympathetic outflow in pithed rats. PMID: 23420100
  16. D1, D2, and D3 receptors are necessary for spontaneous ultrasonic calling in rats. PMID: 23192317
  17. D3 receptor stimulation contributes to the discriminative stimulus effect of U-50,488H. PMID: 21054688
  18. The D3 dopamine receptor regulates D5 receptor expression and function in renal proximal tubule cells. PMID: 22297482
  19. D2R and D3R in the NAcc have overlapping and distinct roles in processing alerting signals from sensory and environmental cues. PMID: 22394078
  20. RGS4 potently inhibits D(2)R/D(3)R signaling. PMID: 21896332
  21. Imbalances in striatal D3 receptor and its splice variant D3nf expression accompany enhanced D3 activity. PMID: 21389298
  22. Inhibitory constants of D2 and D3 receptor-selective compounds were determined using [3H]-PHNO and [3H]-raclopride. PMID: 20936685
  23. A D3 receptor interaction with Galpha12/Galpha13 increasing sodium excretion may regulate blood pressure. PMID: 21633357
  24. ETB receptors interact differently with D receptors in WKY rats and SHRs, potentially explaining the blunted natriuretic effect in SHRs. PMID: 21228598
  25. Dopamine D3 (and D2) receptors interact with nociceptin in the substantia nigra in a Parkinson's disease model. PMID: 21215744
  26. Increased D3 DAR surface expression on cocaine withdrawal day 45 may enhance cocaine-seeking after prolonged withdrawal. PMID: 20435100
  27. D(3) receptors might mediate a protective response to serum deprivation in malignant peripheral nerve sheath tumor cells by inhibiting NF1 gene expression. PMID: 20811714
  28. Peripheral dopamine D2 receptors and, partly, dopamine D3 and central dopamine D2/D3 receptors regulate gastric motility in rats. PMID: 20888837
  29. D(2)/D(3) receptor agonists reinstate food seeking at higher doses and potentiate food-primed reinstatement at lower doses, primarily through D(2) receptors. PMID: 12525958
  30. D3 receptors are important in behavioral sensitization to levodopa in dopaminergic denervation. PMID: 12535962
  31. While D3-preferring agonists may affect reward mechanisms, D3 receptor modulation does not significantly alter cocaine's place conditioning effect. PMID: 12544838
  32. Cabergoline, lisuride, pergolide, and pramipexole have comparable affinities for the D3 receptor. PMID: 14523624
  33. No evidence supports D3 receptor involvement in SHR hypertension pathogenesis. PMID: 14621190
  34. Unlike in 6-hydroxydopamine-treated rats, L-dopa does not reverse BDNF mRNA loss or elevate D3 receptor numbers in zitter mutant rats. PMID: 15081599
  35. Ten polymorphisms were found in the 5' flanking region and four intronic polymorphisms in the rat D3 receptor gene. PMID: 15140009
  36. The D3 dopamine receptor is expressed in the subcommissural organ (SCO). PMID: 15197646
  37. DA receptors, particularly D3R, function on blasts entering the brain. PMID: 15319371
  38. D3 receptors in subventricular zone (SVZ) cells mediate mitogenic activity, likely driving SVZ cell division. PMID: 15584906
  39. Central DA-2 and DA-3 receptor distributions were mapped in Wistar-Kyoto and Wistar rats. PMID: 16574158
  40. Increased renal AT(1) receptor expression due to decreased D(3) receptor regulation may contribute to hypertension. PMID: 16902178
  41. Long-term alcohol consumption upregulates the dopamine D3R, potentially contributing to alcohol-seeking and relapse. PMID: 17077299
  42. D3 receptor alterations contribute to the ci3 rat's behavioral phenotype. PMID: 17187934
  43. D2/3 receptor availability is significantly reduced in the nucleus accumbens of impulsive rats, independent of DA release. PMID: 17332411
  44. D3 receptor activation's effect on novelty-induced locomotor activity was studied in two rat strains. PMID: 17952413
  45. Dopamine D3 receptors play a role in conditioned fear expression. PMID: 17996231
  46. D1-like and D3 dopamine receptors inhibit norepinephrine-induced proliferation in vascular smooth muscle cells. PMID: 18441198
  47. Abnormal D(3)/ETB receptor interactions may explain the blunted natriuretic effect of dopamine in SHRs. PMID: 18547994
  48. Reduced D3 receptors enhance cortical responsiveness to psychostimulants, decreasing drug-seeking behavior. A sensitive period exists for juvenile MPH exposure impacting cortical development. PMID: 18588536
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly in limbic areas of brain.

Q&A

How is the recombinant rat D3 dopamine receptor typically expressed in experimental systems?

Recombinant rat D3 dopamine receptor is most effectively expressed using a baculovirus expression system, which provides an enriched source of biologically and immunologically active receptors. The expression in Spodoptera frugiperda insect (Sf9) cells typically yields receptor densities of 5 to 15 pmol/mg of protein, making this system ideal for pharmacological and structural studies . These expressed receptors maintain their biological properties, displaying high affinity for antagonists such as eticlopride, fluphenazine, and spiroperidol, as well as agonists like N-propylnorapomorphine . A key characteristic of these expressed D3 receptors is that their agonist binding properties are not sensitive to GTP, which distinguishes them from other dopamine receptor subtypes . Transfected mammalian cell lines can also be used for D3 receptor expression, though they typically yield lower expression levels compared to the baculovirus system but may better represent native receptor properties for certain functional studies.

What techniques are most effective for detecting and quantifying D3 receptor expression in tissue samples?

Multiple complementary techniques enable reliable detection and quantification of D3 receptor expression in tissue samples. Quantitative autoradiography using ligands such as [125I]7-OH-PIPAT provides excellent spatial resolution for mapping D3 receptor distribution in brain sections, allowing detection even in regions with relatively low expression levels . Immunohistochemistry using specific antibodies against D3 receptors reveals cellular and subcellular localization, with characteristic punctate distribution patterns observed at the plasma membrane of cells in regions like the nucleus accumbens shell and substantia nigra . Western blotting with D3-specific antibodies can identify receptor protein with molecular weights ranging from 45-80 kDa, providing information about potential post-translational modifications . Single-cell RT-PCR offers high sensitivity for detecting D3 receptor mRNA in individual neurons, enabling co-expression studies with other neurotransmitter receptors and signaling molecules . For functional studies, transgenic reporter systems such as the drd3-EGFP mice provide a powerful approach for identifying and isolating D3-expressing cells for further characterization .

What is the anatomical distribution of D3 receptors in the rat brain?

The D3 dopamine receptor exhibits a distinctive expression pattern in the rat brain with region-specific concentration differences. The highest levels of D3 receptor expression are found in the islands of Calleja and mammillary bodies, where dense immunoreactivity and binding signals are consistently observed across studies . Moderate to low expression levels are detected in the shell of nucleus accumbens (AccSh), frontoparietal cortex, substantia nigra (SN), ventral tegmental area (VTA), and lobules 9 and 10 of the cerebellum . In contrast, very low or undetectable levels are typically found in other brain regions, including the dorsal striatum, where D1 and D2 receptors predominate . Within the SN/VTA region, D3 receptor immunoreactivity is found on both afferent terminals arising from the nucleus accumbens and on tyrosine hydroxylase (TH)-positive dopaminergic neurons, where they may function as autoreceptors controlling dopamine neuron activities . Interestingly, D3 receptor expression has also been detected in serotonergic dorsal and median raphe nuclei, suggesting a distribution pattern that is more widespread than previously appreciated .

How can D3 receptors be distinguished from other dopamine receptor subtypes in experimental settings?

Distinguishing D3 receptors from other dopamine receptor subtypes, particularly the closely-related D2 receptor, requires multiple complementary approaches. Pharmacological discrimination relies on selective ligands such as [125I]7-OH-PIPAT or [125I]R(+)trans-7-hydroxy-2-[N-propyl-N-(3'-iodo-2'-propenyl)amino] tetralin, which exhibit preferential binding to D3 over D2 receptors . Immunological methods using antibodies raised against synthetic peptides designed from unique sequences in the D3 receptor, particularly within the third intracellular loop, can specifically detect D3 receptors without cross-reactivity with D2 receptors . Genetic approaches using D3 receptor knockout mice provide definitive controls for validating D3-specific signals, as demonstrated by the absence of D3 receptor binding or immunoreactivity in D3R-deficient mouse brain . Functional discrimination can be achieved by examining the GTP-insensitivity of agonist binding to D3 receptors, which contrasts with the GTP-sensitivity typically observed with D2 receptors . Combined anatomical and cellular characterization is also valuable, as D3 receptors show a more restricted brain distribution compared to D2 receptors and exhibit distinctive subcellular localization patterns.

What are the critical considerations for maintaining recombinant D3 receptor stability in experimental preparations?

Maintaining the stability and functionality of recombinant D3 dopamine receptors requires careful attention to several experimental parameters. Buffer composition significantly impacts receptor stability, with optimized detergent concentrations being crucial for solubilization while preserving receptor structure and ligand binding properties . Temperature control is essential during all experimental procedures, with D3 receptors typically showing greater stability at lower temperatures (4°C) for short-term storage and -80°C for long-term storage when properly supplemented with glycerol or other cryoprotectants. Protease inhibitor cocktails should be included in all buffers used for receptor isolation and purification to prevent degradation, as proteolytic cleavage can occur particularly within the third intracellular loop where antigenic regions are located . Expression system selection affects receptor post-translational modifications and stability, with insect cell systems like Sf9 cells providing high yield but potentially different glycosylation patterns compared to mammalian expression systems . When performing immunoprecipitation or immunoblotting, careful validation of antibody specificity is essential, ideally using controls such as preincubation with immunization peptides to confirm specific binding and rule out cross-reactivity with other dopamine receptor subtypes .

What experimental approaches can effectively differentiate the pharmacological properties of D3 receptors from D2 receptors?

Differentiating the pharmacological properties of D3 receptors from D2 receptors requires sophisticated experimental strategies due to their structural and functional similarities. Radioligand binding assays utilizing D3-preferring ligands such as [125I]7-OH-PIPAT or [125I]R(+)trans-7-hydroxy-2-[N-propyl-N-(3'-iodo-2'-propenyl)amino] tetralin can achieve pharmacological discrimination, but must be conducted with careful analysis of binding kinetics and competition curves to distinguish the subtle differences in binding profiles . Nucleotide sensitivity tests provide critical differentiation, as D3 receptor agonist binding displays distinctive GTP-insensitivity compared to the marked GTP sensitivity observed with D2 receptors, allowing for functional discrimination in membrane preparations or solubilized receptors . Signal transduction pathway analysis can reveal differences in downstream effectors, as D3 receptors show preferential coupling to specific G-protein subunits and unique regulation of effectors such as adenylate cyclase and potassium channels compared to D2 receptors . Site-directed mutagenesis studies targeting non-conserved residues between D2 and D3 receptors can identify the structural determinants of ligand selectivity and signaling preferences, providing mechanistic insights into their pharmacological differences. Combining recombinant expression systems with native tissue preparations from D3 receptor knockout mice offers powerful validation, allowing researchers to isolate D3-specific signals and determine if observed effects in wild-type tissues are attributable to D3 or D2 receptors .

How do post-translational modifications affect D3 receptor function in recombinant systems versus native tissue?

Post-translational modifications significantly impact D3 receptor function, with important differences between recombinant systems and native tissue contexts. Glycosylation patterns of D3 receptors expressed in insect cells differ from those in mammalian systems, potentially affecting ligand binding properties and cell surface expression, as evidenced by the 45-80 kDa molecular weight range observed in Western blot analyses that suggests variable glycosylation states . Phosphorylation states regulate receptor desensitization and internalization dynamics, which may differ between heterologous expression systems and native neurons due to varied expression levels of relevant kinases and phosphatases, potentially explaining functional differences observed in experimental settings. Palmitoylation affects D3 receptor membrane localization and protein-protein interactions, with the distinctive punctate distribution pattern observed at the plasma membrane of native neurons potentially resulting from specific lipid modifications that may not be faithfully reproduced in recombinant systems . Recombinant systems typically express D3 receptors at significantly higher densities (5-15 pmol/mg in Sf9 cells) than those found in native tissue, potentially altering receptor clustering and dimerization properties that depend on expression level and membrane composition . The cellular microenvironment in native tissue provides specific interacting proteins and scaffolding molecules that can modify receptor function and aren't present in recombinant systems, explaining why certain signaling characteristics may differ between isolated recombinant receptors and their native counterparts.

What methodologies are optimal for investigating D3 receptor co-expression with other neurotransmitter receptors?

Investigating D3 receptor co-expression with other neurotransmitter receptors requires sophisticated methodological approaches to maintain cellular resolution and receptor specificity. Single-cell RT-PCR represents a powerful technique for definitively establishing co-expression patterns at the transcriptional level, allowing simultaneous detection of D3 receptors alongside other dopamine receptor subtypes, adenylate cyclase, GIRK channels, and markers for neuronal subtypes (glutamatergic, GABAergic, or catecholaminergic) . Fluorescent reporter transgenic models, such as the drd3-EGFP transgenic mice where EGFP expression is driven by the D3 receptor gene promoter, enable isolation of D3-expressing cells for subsequent molecular characterization, providing a valuable platform for studying co-expression patterns with regional, sex, and age-dependent variations . Double or triple immunofluorescence labeling with antibodies against D3 receptors and other receptor proteins allows visualization of co-localization at the cellular and subcellular levels, though careful validation of antibody specificity is essential to avoid false-positive results . Proximity ligation assays and FRET/BRET techniques can reveal not just co-expression but physical interactions between D3 receptors and other receptors, potentially indicating functional receptor heteromers in native tissues. Functional co-expression studies combining electrophysiology with pharmacological tools targeting specific receptor subtypes can demonstrate how D3 receptors modulate or are modulated by other neurotransmitter systems, revealing integrated signaling networks beyond simple co-localization .

How can lesion studies be optimized to understand the cellular localization of D3 receptors?

Lesion studies provide powerful insights into the cellular localization of D3 receptors but require careful methodological optimization to yield reliable and interpretable results. Neurotoxin selection is critical, with 6-hydroxydopamine specifically lesioning dopaminergic neurons, quinolinic acid targeting striatal projection neurons, and 5,7-dihydroxytryptamine affecting serotonergic cells—each providing distinct information about the cellular sources of D3 receptor expression . Stereotaxic precision during toxin administration is essential for selective targeting of specific neuronal populations while minimizing damage to surrounding regions, requiring careful optimization of injection coordinates, volumes, and rates for each brain region under investigation . Lesion verification through multiple measures (histological assessment of tissue damage, neurochemical markers of specific cell populations, and behavioral tests when appropriate) provides crucial validation of lesion specificity and completeness before interpreting changes in D3 receptor expression . Quantitative receptor autoradiography using [125I]7-OH-PIPAT combined with immunohistochemistry for cell-type markers in adjacent sections offers comprehensive assessment of how lesions affect D3 receptor density across brain regions with excellent anatomical resolution . Time-course studies examining D3 receptor expression at multiple time points following lesioning can distinguish between direct effects on receptor-expressing cells versus secondary adaptations in interconnected circuits, providing insights into the plasticity of the D3 receptor system .

What are the experimental challenges in studying D3 autoreceptor function in dopaminergic neurons?

Studying D3 autoreceptor function in dopaminergic neurons presents several experimental challenges requiring specialized approaches for accurate characterization. Isolating D3-specific autoreceptor function from D2 autoreceptor effects is particularly challenging as both receptors are expressed on dopaminergic neurons and can modulate similar signaling pathways, necessitating pharmacological tools with exceptional subtype selectivity or genetic models with selective receptor knockout . Maintaining the integrity of presynaptic terminals during ex vivo preparations is critical since autoreceptors are often localized to these structures, requiring carefully optimized slice preparation techniques that preserve terminal function for electrophysiological or neurochemical studies . Measuring dopamine release with sufficient temporal and spatial resolution to detect autoreceptor-mediated modulation requires specialized techniques such as fast-scan cyclic voltammetry or amperometry, which must be combined with selective pharmacological tools to isolate D3 contributions . The heterogeneity of dopaminergic neurons across midbrain regions (substantia nigra, ventral tegmental area, retrorubral field) means that D3 autoreceptor function may vary between subpopulations, requiring precise targeting of specific neuronal groups for accurate characterization . Distinguishing constitutive versus activity-dependent D3 autoreceptor function necessitates experimental paradigms that can separate tonic inhibition from phasic feedback regulation, potentially through combinations of optogenetic stimulation with real-time dopamine detection and receptor antagonism .

How can transgenic mouse models be optimized for studying D3 receptor function in vivo?

Optimizing transgenic mouse models for D3 receptor function studies requires careful consideration of several key factors to maximize research value and interpretability. Promoter selection is critical when designing reporter systems like the drd3-EGFP mice, where the EGFP reporter gene is placed under the control of the D3 receptor gene promoter rather than creating a fusion protein, allowing visualization of cells that natively express D3 receptor mRNA without altering receptor function . Validation of transgene expression patterns through multiple complementary techniques (in situ hybridization, immunohistochemistry, single-cell RT-PCR) is essential to confirm that fluorescent labeling accurately reflects endogenous D3 receptor expression across different brain regions . Genetic background standardization is necessary when comparing findings across studies or generating compound transgenic lines, as strain differences can significantly impact D3 receptor expression patterns and behavioral phenotypes associated with dopaminergic function . Age and sex considerations must be incorporated into experimental designs, as D3 receptor expression shows developmental regulation and sexual dimorphism, with studies ideally examining both male and female subjects at precisely defined age points (e.g., P35 periadolescent versus P70 adult) . Combining reporter models with conditional knockout or knockin approaches creates powerful tools for studying region-specific or cell-type-specific D3 receptor functions, enabling precise manipulation of receptor expression in defined neuronal populations while maintaining visualization capabilities .

What is the significance of D3 receptor expression in non-neuronal cells and potential research applications?

The expression of D3 receptors in non-neuronal cells represents an emerging area of research with significant implications for understanding receptor function beyond classical neurotransmission. In glioblastoma (GBM) cells, D3 receptor expression has been identified as a potential therapeutic target, with novel D3 antagonists demonstrating efficacy in decreasing the growth of GBM xenograft-derived neurosphere cultures while exhibiting minimal toxicity to normal human astrocytes and induced pluripotent stem cell-derived neurons . The correlation between higher D3 receptor levels and worse prognosis in primary, MGMT unmethylated tumors suggests a clinically relevant role in chemotherapy-resistant GBM tumors, with D3 antagonists potentially remaining efficacious where standard treatments fail . The brain penetrance properties of D3 antagonists like SRI-21979 and SRI-30052 make them particularly promising for targeting central nervous system tumors, highlighting the importance of understanding both the pharmacokinetic and pharmacodynamic properties of compounds targeting D3 receptors in non-neuronal contexts . Understanding the signaling mechanisms downstream of D3 receptors in non-neuronal cells may reveal novel pathways distinct from those characterized in neurons, potentially explaining why some D3 antagonists (like SRI-21979) reduce growth of TMZ-resistant GBM cells while others (like haloperidol) do not, despite both having D3 antagonist properties . This expanded view of D3 receptor function necessitates careful consideration of cell-type-specific signaling when developing therapeutic strategies or interpreting experimental data across different cellular contexts.

How do age and sex differences affect D3 receptor expression and function in experimental models?

Age and sex differences significantly impact D3 receptor expression and function, introducing important variables that must be controlled in experimental designs. Developmental regulation of D3 receptor expression shows distinct patterns across brain regions, with studies in transgenic reporter mice revealing different expression profiles between periadolescent (P35) and adult (P70) stages, suggesting that experimental findings may not be generalizable across age groups without specific validation . Sex-dependent differences in D3 receptor co-expression with other dopamine receptor subtypes have been documented, with region-specific patterns that may contribute to sexually dimorphic responses to dopaminergic drugs and sex differences in dopamine-related behaviors and disorders . Hormonal influences on D3 receptor expression and function represent a likely mechanism underlying sex differences, though few studies have directly examined how estrogens, androgens, or their fluctuations affect D3 receptor systems specifically, presenting an important area for future investigation . Age-related changes in D3 receptor signal transduction efficiency may occur independently of receptor density, potentially due to alterations in G-protein coupling, scaffolding proteins, or downstream effectors, requiring functional assays alongside expression studies to fully characterize age effects . Experimental designs should ideally include both male and female subjects across multiple developmental stages (at minimum including adolescent and adult cohorts) with sufficient statistical power to detect interaction effects between age and sex factors on D3 receptor measures .

What are the key controls required for validating D3 receptor antibodies in immunological studies?

Validating D3 receptor antibodies for immunological studies requires multiple rigorous controls to ensure specificity and reliability of results. Expression system validation using cells transfected with recombinant D3 receptors but not other dopamine receptor subtypes (particularly D2) provides the foundation for antibody specificity testing, with positive immunoreactivity expected only in D3-expressing cells . Peptide competition experiments, where the antibody is preincubated with the immunization peptide before application to samples, should abolish specific immunoreactivity in both Western blots and immunohistochemistry, confirming that binding occurs through the intended epitope . Knockout tissue controls from D3 receptor-deficient mice represent the gold standard validation approach, as specific antibodies should show no significant immunoreactivity in these tissues compared to wild-type controls, providing definitive evidence of specificity . Multi-technique concordance between immunohistochemical staining patterns and other measures of D3 receptor distribution (such as radioligand binding or in situ hybridization) strengthens confidence in antibody specificity, with similar regional and cellular patterns expected across methods . Western blot analysis should demonstrate detection of proteins in the expected molecular weight range (45-80 kDa for D3 receptors) with minimal non-specific bands, while recognizing that post-translational modifications may result in some size heterogeneity .

How should researchers optimize receptor binding assays for studying D3 dopamine receptors?

Optimizing receptor binding assays for D3 dopamine receptors requires careful attention to multiple technical parameters to achieve reliable and reproducible results. Ligand selection is critical, with [125I]7-OH-PIPAT or [125I]R(+)trans-7-hydroxy-2-[N-propyl-N-(3'-iodo-2'-propenyl)amino] tetralin offering advantages for D3 receptor studies due to their preferential binding to D3 over D2 receptors, though competition studies with unlabeled ligands of known selectivity profiles are necessary to fully characterize binding sites . Assay buffer composition significantly impacts binding parameters, with optimal conditions typically including physiological pH (7.4), controlled ionic strength, and specific protease inhibitors to prevent receptor degradation during the assay . Tissue preparation methods must be optimized based on the specific research question, with membrane preparations being suitable for most applications, while solubilized receptors may be required for immunoprecipitation studies or when examining receptor-protein interactions . Non-specific binding determination should utilize structurally diverse displacers at saturating concentrations (typically 1-10 μM of agents like eticlopride or haloperidol) to establish reliable baseline values, with non-specific binding ideally kept below 20% of total binding for accurate determination of specific binding . Saturation binding experiments with 6-8 concentrations spanning two orders of magnitude around the expected Kd value are essential for accurately determining receptor density (Bmax) and affinity (Kd), while competition assays with 10-12 concentrations of competing ligands provide detailed pharmacological profiles and can reveal receptor heterogeneity when analyzed using appropriate curve-fitting models .

What are the critical parameters for establishing recombinant D3 receptor expression systems?

Establishing effective recombinant D3 receptor expression systems requires optimization of several critical parameters to achieve functional receptor production. Vector design significantly impacts expression levels, with mammalian expression vectors typically containing strong promoters (CMV, SV40) for cell line studies, while baculovirus vectors using polyhedrin or p10 promoters are preferred for high-yield insect cell expression, with both systems benefiting from inclusion of sequences that enhance mRNA stability and translation efficiency . Host cell selection balances expression levels against proper post-translational processing, with Sf9 insect cells providing high expression levels (5-15 pmol/mg) but potentially different glycosylation patterns compared to mammalian cells like HEK293 or CHO, which may better recapitulate native receptor properties at the cost of lower expression . Transfection/infection conditions require careful optimization of parameters including cell density at transfection, DNA:transfection reagent ratios for mammalian cells, or viral multiplicity of infection and harvest timing for baculovirus systems, with systematic optimization experiments necessary to identify conditions yielding maximum functional receptor expression . Quality control assessments should include both binding studies to confirm ligand recognition properties and functional assays (G-protein coupling, downstream signaling) to verify that expressed receptors maintain their biological activity, with results compared to native receptors where possible . For stable mammalian cell lines, selection marker choice and concentration must be empirically determined to balance selection stringency against cell health, with clonal isolation and screening typically necessary to identify cells with optimal expression levels and functional characteristics .

What approaches are effective for studying D3 receptor signaling pathways in neuronal contexts?

Studying D3 receptor signaling pathways in neuronal contexts requires specialized approaches that maintain cellular integrity while providing sufficient resolution for pathway dissection. Primary neuronal cultures from brain regions with endogenous D3 expression provide physiologically relevant systems for signaling studies, while transgenic reporter lines facilitate identification of D3-expressing neurons for targeted investigations using electrophysiology or calcium imaging . Single-cell electrophysiology combined with pharmacological tools allows real-time assessment of D3 receptor modulation of neuronal excitability and ion channel function, revealing how receptor activation impacts cellular physiology with high temporal resolution . GIRK channel modulation represents a key D3 receptor signaling outcome that can be measured using patch-clamp techniques, with studies in D3-expressing neurons revealing region-specific co-expression patterns with different GIRK channel isoforms that may contribute to varied functional responses . Measuring changes in second messenger systems (cAMP levels, calcium mobilization, MAPK activation) in response to selective D3 receptor agonists and antagonists can map downstream signaling cascades, though careful pharmacological controls are needed to isolate D3-specific effects from those mediated by other dopamine receptors . Viral-mediated expression of genetically-encoded biosensors for various signaling molecules (cAMP, calcium, G-protein activation) in D3-expressing neurons allows real-time visualization of spatiotemporal signaling dynamics in response to receptor activation, providing insights into compartmentalized signaling within complex neuronal morphologies .

How can researchers effectively utilize D3 receptor antagonists as experimental tools or potential therapeutics?

Utilizing D3 receptor antagonists as experimental tools or potential therapeutics requires careful compound selection and validation strategies to ensure target specificity and appropriate pharmacological properties. Selectivity profiling against other dopamine receptor subtypes (particularly D2) and non-target receptors is essential, with comprehensive binding assays and functional screens necessary to establish the specificity ratio and potential off-target effects that could confound experimental interpretation or introduce unwanted side effects in therapeutic contexts . Brain penetrance assessment is critical for CNS applications, requiring pharmacokinetic studies that measure brain:plasma ratios after systemic administration, as demonstrated with compounds like SRI-21979 and SRI-30052 that showed favorable brain distribution properties essential for targeting central D3 receptors . Dose-response relationships should be carefully established in relevant model systems, with SRI-21979 and SRI-30052 showing efficacy against GBM cell growth at concentrations that produced minimal toxicity in normal human astrocytes or induced pluripotent stem cell-derived neurons, establishing a therapeutic window that is essential for both experimental and therapeutic applications . Mechanism of action characterization through pathway-specific assays helps distinguish direct receptor antagonism from potential alternative mechanisms, particularly important when observing unexpected effects like the ability of some D3 antagonists to inhibit TMZ-resistant GBM cell growth while others with D3 antagonist properties fail to show similar effects . For therapeutic development, formulation optimization and toxicology studies are necessary steps beyond initial efficacy demonstrations, with promising compounds moving through increasingly rigorous testing to establish safety margins and identify potential adverse effects before clinical translation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.