Recombinant Rat D (4) dopamine receptor (Drd4)

Shipped with Ice Packs
In Stock

Description

Production Systems for Recombinant Rat DRD4

Common expression platforms:

HEK293 cells

  • Advantages: Proper post-translational modifications

  • Typical yield: 0.5-1 mg/L culture

coli

  • Advantages: Cost-effective for structural studies

  • Limitations: Lacks mammalian glycosylation patterns

Tagging strategies:

  1. Histidine (His)-tag: Facilitates immobilized metal affinity chromatography

  2. FLAG-tag: Enables immunoaffinity purification

  3. Avi-tag: Allows site-specific biotinylation for surface immobilization

Experimental Applications

Primary research uses:

  • Radioligand binding assays to quantify receptor-ligand interactions

  • Functional BRET/FRET studies of receptor oligomerization

  • Electrophysiological characterization in transfected neurons

Key pharmacological findings:

LigandBinding Affinity (K<sub>i</sub>)Functional Response
Dopamine23 nM Full agonist (EC<sub>50</sub> 110 nM)
L7458700.43 nM Competitive antagonist
Clozapine38 nM Inverse agonist

Detection and Quantification

The Rat Dopamine Receptor D4 ELISA Kit (RTDL00310) demonstrates:

Performance characteristics:

ParameterSpecification
Sensitivity0.057 ng/mL
Dynamic range0.156-10 ng/mL
Intra-assay CV<10%
Inter-assay CV<12%
Recovery rate85-115% in biological matrices

Validated for use with:

  • Brain tissue homogenates

  • Cerebrospinal fluid

  • Transfected cell lysates

Research Implications

  1. ADHD mechanisms: DRD4 modulates frontal cortico-striatal glutamate release, with recombinant receptors enabling studies of impulsivity pathways

  2. Drug development: Used to screen subtype-selective compounds avoiding extrapyramidal side effects

  3. Receptor oligomerization: Facilitates investigation of DRD4-α<sub>2A</sub> adrenergic receptor heteromers impacting noradrenergic signaling

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly indicate them in your order remarks. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on your purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and serves as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Drd4; D(4 dopamine receptor; D(2C dopamine receptor; Dopamine D4 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASER ILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVC CLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRK RGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC
Uniprot No.

Target Background

Function
The dopamine receptor D4 (Drd4) plays a crucial role in neuronal signaling within the mesolimbic system of the brain. This region regulates emotions and complex behaviors. Drd4 is activated by dopamine, epinephrine, and norepinephrine, as well as various synthetic agonists and drugs. Agonist binding initiates signaling via G proteins, leading to the inhibition of adenylyl cyclase. Drd4 also modulates the circadian rhythm of contrast sensitivity by regulating the rhythmic expression of NPAS2 in retinal ganglion cells.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Central nervous system: hypothalamus, thalamus, olfactory bulb, and frontal cortex.

Q&A

What is the molecular structure of rat Drd4 receptor?

The rat D(4) dopamine receptor (Drd4) belongs to the G protein-coupled receptor (GPCR) family. Its structure includes seven transmembrane (TM) domains, with an extracellular N-terminus and an intracellular C-terminus. The rat Drd4 shares significant homology with mouse Drd4, which has been crystallized at 3.5-angstrom resolution. As observed in mouse models, the Drd4 receptor forms a typical GPCR structure with the TM regions organizing into continuous layers when crystallized. The receptor can form non-symmetrical dimers in crystallography asymmetric units, with the two protomers related by a 44° rotation about an axis perpendicular to the membrane plane in addition to non-crystallographic translation .

Crystal structure analysis reveals that TMs 5 and 6 of the receptor can form continuous helices with helix pairs from fusion proteins used in crystallization techniques. This structural feature appears to provide more rigid packing, potentially explaining why certain mutations (such as P201 5.52I and P317 6.38A) have been found necessary for successful crystallization of these receptors . Understanding this structure is crucial for researchers developing selective ligands for the Drd4 receptor.

How does rat Drd4 compare with human DRD4 in terms of sequence homology?

When comparing rat Drd4 with human DRD4, researchers should note the significant sequence homology between these receptors, though there are species-specific differences. Based on studies with mouse Drd4, which is closely related to rat Drd4, we can infer that rat Drd4 likely shares approximately 66% identity with human DRD4 in the whole amino acid sequence and about 89% identity specifically in the transmembrane (TM) region . These similarities make rat models valuable for preliminary research, while the differences must be considered when translating findings to human applications.

The third intracellular loop (ICL3) region represents one of the most variable sections between species and contains important polymorphic regions in humans. In human DRD4, this region contains variable number tandem repeats (VNTRs) of a 48-base pair sequence, resulting in different receptor variants (D4.2R, D4.4R, D4.7R) . Researchers should be aware that rat Drd4 does not exhibit the same polymorphic variation in this region as human DRD4, which has implications for translational research, particularly in studies of neuropsychiatric disorders associated with specific human polymorphisms.

Where is Drd4 primarily expressed in rat tissues?

Rat Drd4 receptor expression varies across tissues, with significant presence in neural tissues. In the rat retina, Drd4 expression shows distinctive patterns with the highest expression confined to photoreceptors . This localization pattern suggests an important role for Drd4 in visual processing and photoresponse. Beyond the retina, Drd4 is also expressed in the rat brain, with notable presence in frontal cortical regions and striatal areas, similar to the distribution patterns observed in other mammals.

Interestingly, Drd4 expression in rat retina demonstrates a prominent day/night variation, with peak expression occurring during the nighttime as demonstrated through in situ hybridization techniques . This circadian regulation of Drd4 expression suggests potential involvement in light adaptation processes and daily physiological rhythms. Researchers studying Drd4 function should consider these temporal expression patterns when designing experiments, particularly when investigating the receptor's role in visual processing or circadian-regulated behaviors.

What techniques are effective for expressing recombinant rat Drd4 for structural studies?

For successful expression and crystallization of recombinant rat Drd4, researchers have employed several specialized techniques. Protein engineering in combination with lipidic cubic phase (LCP) methods has proven effective for Drd4 structural studies. The engineering approach typically involves replacing the long, presumably disordered intracellular loop 3 (ICL3) with a more stable protein domain to enhance crystallization properties. For instance, in mouse Drd4 studies, researchers replaced residues in the ICL3 region with thermostabilized apocytochrome b562RIL (BRIL) .

Additionally, strategic point mutations can significantly improve protein stability and crystallization outcomes. Three mutations found beneficial in mouse Drd4 studies (which may be applicable to rat Drd4) include P201 5.52I, P317 6.38A, and C181 45.51R. The first two mutations were necessary for proper crystallization, while the third improved diffraction quality. Such modifications can substantially increase the thermal stability of the receptor, as evidenced by a 13°C increase in melting temperature (Tm) compared to wild-type protein . Adding a selective antagonist like L745870 during purification can further stabilize the receptor, with studies showing an additional 20°C increase in Tm when this compound is present.

How can researchers detect and measure Drd4 expression levels in rat tissues?

Several methodological approaches are available for detecting and quantifying Drd4 expression in rat tissues. In situ hybridization represents a powerful technique for visualizing the spatial distribution of Drd4 mRNA within tissue sections. This approach has been successfully used to demonstrate day/night variations in Drd4 expression in rat retina . The technique allows for precise localization of expression patterns at the cellular level, which is particularly valuable for heterogeneous tissues.

For quantitative analysis of Drd4 expression, quantitative PCR (qPCR) provides a sensitive method to measure mRNA levels across different experimental conditions. Researchers should design primers specific to rat Drd4 sequence, with careful attention to avoiding regions that might cross-react with other dopamine receptor subtypes. Protein-level detection can be accomplished through western blotting, immunohistochemistry, or immunofluorescence using antibodies specific to rat Drd4. For functional studies, newer techniques utilizing circular permuted GFP (cpGFP)-fusion dopamine receptor variants can serve as in vivo dopamine-binding reporters , allowing real-time monitoring of receptor activity in living tissues.

What are the recommended methods for studying Drd4 receptor dimerization?

Investigating Drd4 receptor dimerization requires specialized techniques that can detect protein-protein interactions in native or near-native conditions. Bioluminescence resonance energy transfer (BRET) represents a powerful approach for studying Drd4 dimerization and heteromerization. This technique has been successfully applied to investigate interactions between dopamine receptor subtypes and their polymorphic variants . For Drd4 dimerization studies, researchers would typically create fusion constructs with donor (e.g., Renilla luciferase) and acceptor (e.g., YFP) proteins attached to Drd4, then measure energy transfer when the proteins come into close proximity.

A more advanced variation called complemented donor-acceptor resonance energy transfer (CODA-RET) can provide additional insights into the functional consequences of dimerization. This technique has revealed mechanisms underlying the differential functions of human DRD4 polymorphic variants in heteromeric complexes . For crystallography-based approaches, researchers should consider that Drd4 forms non-symmetrical dimers in crystallography asymmetric units , which may provide structural insights into dimerization interfaces. Crosslinking studies followed by mass spectrometry can also help identify specific residues involved in dimer formation, providing valuable information for targeted mutagenesis experiments.

How does rat Drd4 couple to intracellular signaling pathways?

Rat Drd4, like other D2-like dopamine receptors, primarily couples to inhibitory G proteins (Gi/o), leading to inhibition of adenylyl cyclase and reduction in cAMP levels. This coupling initiates various downstream signaling cascades that ultimately influence neuronal excitability and synaptic transmission. Research using BRET techniques with different dopamine receptor variants has demonstrated that these receptors can activate all five Gi/o protein subtypes, though possibly with different efficacies .

The signaling properties of Drd4 are significantly influenced by its ability to form heteromers with other receptor types. In particular, Drd4 can form functional heteromers with dopamine D2 receptors (D2R) and adrenergic α2A receptors (α2AR). These heteromeric complexes exhibit distinct pharmacological and signaling properties compared to receptor homomers. For instance, D2R-D4R heteromers may show altered potency for dopamine and different constitutive activities depending on the specific Drd4 variant involved . Researchers investigating rat Drd4 signaling should consider these heteromerization possibilities and their potential impact on experimental outcomes.

What is the role of Drd4 in the rat retina and its circadian regulation?

In the rat retina, Drd4 displays a distinctive expression pattern with highest levels in photoreceptors, suggesting a specific role in visual processing. This receptor exhibits a pronounced circadian rhythm in expression, with peak levels occurring during the nighttime as demonstrated through in situ hybridization studies . This temporal regulation pattern indicates that Drd4 likely participates in light/dark adaptation mechanisms within the retina.

The circadian regulation of Drd4 expression may be connected to its role in the dopaminergic modulation of melatonin synthesis and release, as observed in pineal gland studies . In the retina, dopamine functions as an important chemical messenger for light adaptation, and the rhythmic expression of Drd4 could represent a molecular mechanism for coordinating retinal sensitivity with daily light cycles. Researchers investigating retinal Drd4 should design their experiments with consideration of these temporal expression patterns, potentially synchronizing tissue collection and analysis with specific circadian time points to capture the full range of receptor expression and function.

How do antagonists like L745870 interact with rat Drd4?

L745870 is a subtype-selective antagonist that binds with high affinity to the Drd4 receptor. Crystal structure studies with mouse Drd4 have provided detailed insights into this interaction, revealing an extended ligand-binding pocket specific for D4-type dopamine receptors. This structural information helps explain the compound's selectivity for Drd4 over other dopamine receptor subtypes .

The binding of L745870 to Drd4 significantly enhances the thermal stability of the receptor, increasing its melting temperature by approximately 20°C compared to the unbound state . This stabilizing effect makes L745870 particularly useful in structural biology studies of Drd4, as it helps maintain the receptor in a stable conformation during crystallization attempts. The interaction between L745870 and Drd4 involves both the orthosteric binding site (the primary binding pocket) and an extended binding pocket that contributes to subtype selectivity. This binding mode creates a conformation that blocks the receptor's ability to be activated by dopamine, thereby antagonizing its function.

How do polymorphic variants of DRD4 differ functionally, and can rat models inform human variants research?

Human DRD4 exhibits significant polymorphic variation in the third intracellular loop region, with the most common variants containing 2, 4, or 7 repeats of a 16 amino acid proline-rich sequence (D4.2R, D4.4R, and D4.7R). These polymorphic variants demonstrate important functional differences, particularly in their ability to form heteromers with other receptors and in their downstream signaling properties. Research has revealed that D4.7R shows a gain of function compared to D4.4R in mediating inhibitory effects on frontal cortico-striatal neurotransmission .

Rat Drd4 lacks the same polymorphic variation found in humans, which creates both limitations and opportunities for researchers. While rats cannot directly model the human polymorphisms, recombinant approaches allow for the creation of "humanized" rat models. For example, viral transduction of human D4.4R and D4.7R variants into D4R knockout mice has enabled comparative studies of their effects on network bursts and NMDA receptor-mediated currents . Similarly, D4.7R knock-in mice expressing a humanized D4R with the third intracellular loop of human D4.7R have been developed. These approaches could be adapted for rat models to study the functional properties of human polymorphic variants in a more complex in vivo system.

What are the implications of Drd4 heteromerization for drug development?

The discovery that Drd4 forms functional heteromers with other receptor types, particularly D2R and α2AR, has significant implications for drug development. These heteromeric complexes display distinct pharmacological properties compared to receptor homomers, including altered ligand potency, efficacy, and constitutive activity. For instance, dopamine shows different potency for D2R-D4.7R heteromers compared to D2R-D4.4R heteromers , suggesting that individuals with different DRD4 polymorphisms might respond differently to dopaminergic medications.

This heteromerization phenomenon provides opportunities for developing more selective therapeutic approaches. Compounds that specifically target receptor heteromers rather than individual receptor subtypes could potentially offer improved therapeutic profiles with reduced side effects. For researchers working with rat Drd4, investigating heteromerization patterns and their functional consequences could provide valuable insights for translational drug development. Techniques such as BRET and CODA-RET can be employed to screen compounds for differential effects on receptor homomer versus heteromer signaling, potentially identifying novel lead compounds with heteromer-selective properties.

How might Drd4 research in rats inform understanding of neuropsychiatric disorders?

Research on human DRD4 has established associations between specific polymorphisms, particularly the D4.7R variant, and neuropsychiatric conditions including attention-deficit hyperactivity disorder (ADHD) and substance use disorders . The mechanistic basis for these associations appears to involve the differential effects of DRD4 variants on frontal cortico-striatal glutamatergic neurotransmission, which influences impulsivity and related behavioral traits.

While rat Drd4 does not naturally exhibit the polymorphic variations found in humans, rat models remain valuable for understanding the fundamental role of Drd4 in neural circuit function. By manipulating rat Drd4 expression or function through genetic or pharmacological approaches, researchers can investigate how alterations in dopaminergic signaling affect behaviors relevant to neuropsychiatric disorders. For instance, studies examining how Drd4 modulates the balance between dopaminergic and glutamatergic transmission in cortico-striatal circuits could provide insights into the neural mechanisms underlying impulse control.

DRD4 VariantAssociation with DisordersSignaling PropertiesHeteromerization Capacity
D4.4R (human)Less strongly associated with ADHDLower potency at D2R-D4.4R heteromersHigher ability to form heteromers with D2R
D4.7R (human)Strongly associated with ADHD and substance use disordersHigher potency at D2R-D4.7R heteromersLower ability to heteromerize with D2R, higher homomerization
Rat Drd4N/A (no equivalent polymorphisms)Similar to human D4R in basic signalingForms heteromers with D2R and α2AR

What are the main challenges in expressing and purifying recombinant rat Drd4?

Expressing and purifying recombinant Drd4 presents several technical challenges common to membrane proteins. The hydrophobic nature of the seven transmembrane domains makes these receptors difficult to express in soluble form and prone to aggregation during purification. Additionally, maintaining the native conformation of Drd4 outside its natural membrane environment represents a significant challenge for structural and functional studies.

To overcome these obstacles, researchers have developed several effective strategies. Protein engineering approaches have proven valuable, particularly the replacement of the long, disordered intracellular loop 3 (ICL3) with more stable protein domains like thermostabilized apocytochrome b562RIL (BRIL) . Strategic point mutations can also enhance receptor stability, as demonstrated with mutations like P201 5.52I and P317 6.38A in mouse Drd4 studies . The inclusion of selective ligands during purification, such as the antagonist L745870, can significantly improve thermal stability, with reported increases in melting temperature of up to 20°C . For expression systems, insect cells (particularly Sf9 or High Five) often provide better yields for GPCRs than bacterial systems, though mammalian cell expression may better preserve post-translational modifications relevant to receptor function.

How can researchers design experiments to study Drd4 circadian rhythms in rat tissues?

Designing experiments to investigate Drd4 circadian rhythms requires careful consideration of temporal sampling and environmental conditions. Based on previous findings showing nighttime peaks in retinal Drd4 expression , researchers should implement sampling protocols that cover multiple time points across the 24-hour cycle. A minimum of six time points is recommended (e.g., ZT0, ZT4, ZT8, ZT12, ZT16, ZT20), with more frequent sampling around anticipated peak and trough times.

What controls and validation steps are essential when studying rat Drd4 selectivity?

When investigating the selectivity of compounds or genetic manipulations targeting rat Drd4, several critical controls and validation steps must be implemented. For pharmacological studies, researchers should confirm compound selectivity by testing binding affinity and functional activity across all five dopamine receptor subtypes (D1-D5), with particular attention to the closely related D2-like family members (D2R and D3R). Competitive binding assays using radiolabeled ligands provide quantitative measures of binding affinity, while functional assays (e.g., cAMP accumulation, β-arrestin recruitment, or GTPγS binding) can assess compound effects on receptor signaling.

For genetic approaches targeting Drd4, validation should include confirmation of successful gene modification (knockout, knockdown, or overexpression) using both mRNA (RT-PCR) and protein (western blot, immunohistochemistry) detection methods. Off-target effects should be assessed by measuring expression levels of other dopamine receptor subtypes to ensure they remain unchanged. When creating transgenic rat models, thorough phenotypic characterization should include behavioral assessments relevant to dopaminergic function, such as locomotor activity, response to psychostimulants, and cognitive tasks. Finally, researchers should consider potential compensatory changes in other neurotransmitter systems that might occur in response to Drd4 manipulation, which could confound interpretation of experimental results.

What are the most promising future directions for rat Drd4 research?

Rat Drd4 research offers numerous promising avenues for future investigation. The development of "humanized" rat models expressing specific human DRD4 polymorphic variants could provide valuable insights into the functional significance of these genetic variations in complex behaviors and neuropsychiatric conditions. Such models would bridge the gap between basic receptor mechanisms and clinically relevant phenotypes. Additionally, further exploration of Drd4 heteromerization patterns in native neural tissues could reveal novel signaling mechanisms and potential therapeutic targets.

The circadian regulation of Drd4 expression in the retina suggests unexplored roles in visual processing and light adaptation that warrant deeper investigation. Understanding the molecular mechanisms controlling this temporal regulation could provide insights into both dopaminergic signaling and circadian biology. Advanced techniques combining optogenetics with real-time receptor activity monitoring could enable unprecedented temporal precision in studying Drd4 function in living tissues. Finally, the potential role of Drd4 in mediating the effects of genetic and environmental risk factors for neuropsychiatric disorders presents an important translational research opportunity, potentially leading to novel therapeutic approaches for conditions like ADHD and substance use disorders.

How might recent advances in GPCR research methodology be applied to rat Drd4 studies?

Recent technological advances in GPCR research offer exciting possibilities for rat Drd4 investigations. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology, potentially enabling structure determination of Drd4 in complex with various ligands and interacting proteins without the need for crystallization. This approach could reveal dynamic conformational changes associated with receptor activation and signaling. Advanced biosensor technologies, such as FRET/BRET-based sensors and cpGFP-fusion constructs , enable real-time monitoring of receptor conformational changes and signaling in living cells and tissues.

In the genomic editing realm, CRISPR-Cas9 technology facilitates precise modification of the Drd4 gene in rats, enabling creation of knockout models, point mutations, or humanized variants with unprecedented efficiency. For studying receptor localization and trafficking, super-resolution microscopy techniques like STORM and PALM overcome the diffraction limit of conventional microscopy, allowing visualization of individual receptors and their dynamic behavior in cellular compartments. Finally, computational approaches including molecular dynamics simulations can complement experimental studies by predicting ligand binding modes, receptor conformational changes, and potential interaction interfaces with other proteins, generating testable hypotheses for further experimental validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.