Recombinant Rat Dipeptidyl peptidase 4 (Dpp4), partial

What is Dipeptidyl peptidase 4 and what are its alternative designations in scientific literature?

Dipeptidyl peptidase 4 (Dpp4) is a cell surface glycoprotein receptor involved in multiple biological processes including T-cell activation, cell adhesion, and endothelial cell migration. In scientific literature, it is alternatively known as bile canaliculus domain-specific membrane glycoprotein, dipeptidyl peptidase IV (DPP IV), GP110 glycoprotein, and T-cell activation antigen CD26 (CD26). The protein exists in multiple forms, including a membrane form, a soluble form, and a 60 kDa soluble form, each with distinct functional properties in biological systems .

What is the molecular structure and characteristics of recombinant rat Dpp4?

The recombinant rat Dpp4 (partial) has a theoretical molecular weight of approximately 30.7 kDa. When produced with an N-terminal 6xHis-SUMO tag, the protein contains the expression region spanning amino acids 638-767. The specific amino acid sequence is: SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR. This partial recombinant protein retains key functional domains that allow researchers to study specific aspects of Dpp4 activity in controlled experimental settings .

How does Dpp4 influence T-cell activation pathways?

Dpp4 functions as a cell surface glycoprotein receptor involved in providing costimulatory signals essential for T-cell receptor (TCR)-mediated T-cell activation. It acts as a positive regulator of T-cell coactivation by binding to multiple proteins including ADA, CAV1, IGF2R, and PTPRC. The binding of Dpp4 to CAV1 and CARD11 specifically induces T-cell proliferation and activates NF-kappa-B in a T-cell receptor/CD3-dependent manner. Additionally, its interaction with ADA regulates lymphocyte-epithelial cell adhesion processes. These molecular interactions highlight the significance of Dpp4 in immunological research, particularly in studies focused on T-cell function and immune regulation .

How can researchers effectively distinguish between the biological effects of Dpp4 inhibition versus Dpp8/Dpp9 inhibition in experimental models?

Distinguishing between Dpp4 and Dpp8/Dpp9 inhibition requires a multi-faceted approach. First, researchers should establish baseline enzymatic activities of all three proteases in their experimental system using selective substrates. For rat models, comparing wild-type rats with Dpp4-deficient rats provides a genetic approach to isolate Dpp4-specific effects. When using pharmacological inhibitors, selectivity testing is crucial - implement the established evaluation method using recombinant human DPP8 and DPP9 proteins expressed in Rosetta cells, where the optimum concentrations for testing are 30 ng/mL for DPP8 and 20 ng/mL for DPP9, with substrate concentrations of 0.2 mmol/L for both enzymes .

Secondary validation should include monitoring specific downstream biomarkers unique to each pathway - plasma GLP-1 levels increase specifically with Dpp4 inhibition but remain unaffected by Dpp8/Dpp9 inhibition. Finally, toxicity profiling can help identify Dpp8/Dpp9 inhibition, as these produce distinct adverse effects not seen with selective Dpp4 inhibition .

What molecular mechanisms explain the attenuation of diabetic kidney injury observed in Dpp4-deficient rat models?

The attenuation of diabetic kidney injury in Dpp4-deficient rats involves several interconnected molecular pathways. Primary among these is the elevation of circulating GLP-1 levels, which was confirmed through rat-specific GLP-1 ELISA measurements showing significantly higher plasma concentrations in Dpp4-deficient rats compared to wild-type controls .

This increased GLP-1 activity leads to reduced advanced glycation end-products (AGEs) formation through multiple mechanisms:

• Enhancement of glyoxalase-1 (GLO-1) expression and activity, which was demonstrated in mesangial cells where Ex-4 (a GLP-1 receptor agonist) reversed MGO-induced reduction in GLO-1 mRNA and protein levels

• Activation of nuclear factor erythroid 2-related factor 2 (Nrf-2), evidenced by increased protein expression and nuclear translocation in response to Ex-4 treatment

• Suppression of receptor for AGEs (RAGE) expression, observed both in vivo where RAGE protein was barely detectable in Dpp4-deficient rats, and in vitro where Ex-4 treatment suppressed MGO-induced RAGE expression

Additionally, Dpp4 deficiency significantly reduces inflammatory and fibrotic responses by decreasing the expression of cytokines (TNF-α, IL-6, MCP-1) and fibrotic factors (TGF-β and fibronectin) that are typically elevated in diabetic nephropathy models .

How can Dpp4 activity modulation influence the AGE/RAGE signaling axis in diabetic models?

Dpp4 activity directly influences the AGE/RAGE signaling axis through GLP-1-dependent mechanisms. When Dpp4 is inhibited or deficient, increased active GLP-1 levels modulate this pathway in multiple ways:

• GLP-1 receptor activation reduces methylglyoxal (MGO) accumulation by enhancing the glyoxalase system, particularly through upregulation of glyoxalase-1 (GLO-1), which detoxifies MGO and prevents AGE formation

• Increased GLP-1 signaling induces Nrf-2 activation and nuclear translocation, which transcriptionally regulates GLO-1 expression, creating a positive feedback loop for MGO detoxification

• Dpp4 inhibition suppresses RAGE expression both directly and by reducing the availability of AGEs that would otherwise induce RAGE upregulation

This multi-level modulation was demonstrated in experimental models where DPP4-deficient diabetic rats showed significantly reduced RAGE protein expression compared to wild-type diabetic controls. The same effect was reproduced in vitro where rat mesangial cells exposed to MGO showed increased RAGE expression that was suppressed by Ex-4 treatment .

The consequence of this inhibition is the reduction of downstream inflammatory and fibrotic responses that contribute to diabetic nephropathy progression, as evidenced by decreased expression of TNF-α, MCP-1, TGF-β, and fibronectin in kidney tissues of Dpp4-deficient diabetic rats .

What are the optimal conditions for producing and purifying recombinant rat Dpp4 for research applications?

The production of high-quality recombinant rat Dpp4 requires a systematic approach with carefully controlled conditions. The recommended protocol begins with appropriate cDNA selection and PCR amplification of the target Dpp4 sequence. Expression plasmids should be constructed with verification through sequence determination before transformation into E. coli expression systems .

For optimal expression and purification:

• Add an N-terminal 6xHis-SUMO tag to facilitate purification and potentially enhance solubility

• Use bacterial expression systems such as E. coli for cost-effective production

• Implement a purification strategy using nickel affinity chromatography for initial capture, followed by size exclusion chromatography for enhanced purity

• Buffer conditions should utilize Tris/PBS-based buffers with 5%-50% glycerol for stability

• For lyophilized preparations, include 6% Trehalose in Tris/PBS-based buffer (pH 8.0) to maintain protein integrity during lyophilization and reconstitution

This approach consistently yields recombinant Dpp4 with >90% purity suitable for research applications. Post-purification, the protein should be stored at -20°C for short term or -80°C for long-term storage, with freeze-thaw cycles minimized to preserve enzymatic activity .

What experimental design considerations are critical when establishing Dpp4-deficient rat models for diabetes research?

When establishing Dpp4-deficient rat models for diabetes research, several critical experimental design factors must be addressed:

Animal Selection and Baseline Characterization:

• Source Dpp4-deficient rats from established providers such as the Rat Resource and Research Center

• Use age-matched controls (typically 6-8 weeks old male Fischer 344 wild-type rats)

• Perform baseline characterizations including blood glucose measurements, HbA1c levels, and Dpp4 activity confirmation prior to any interventions

• Document baseline GLP-1 levels between wild-type and Dpp4-deficient groups

Diabetes Induction Protocol:

• Implement a standardized streptozotocin (STZ) administration protocol: 30 mg/kg/day intraperitoneally after 4 hours fasting, repeated 3 times

• Use citrate buffer (pH 4.5) injections as vehicle controls

• Confirm diabetes induction by monitoring blood glucose levels weekly using a glucose analyzer after 4 hours fasting

• Define clear thresholds for diabetes confirmation (e.g., >300 mg/dL blood glucose)

Experimental Groups Design:

• Establish four experimental groups: wild-type control (WT-CON), wild-type STZ-treated (WT-STZ), Dpp4-deficient control (DPP4-def-CON), and Dpp4-deficient STZ-treated (DPP4-def-STZ)

• Use appropriate sample sizes (minimum n=7-8 per group) to ensure statistical power

Timeline and Endpoints:

• Conduct experiments for a minimum of 42 days after diabetes confirmation

• Measure key parameters including body weight, blood glucose, HbA1c, serum lipids, and kidney function markers

• Collect and properly store tissue samples (especially kidneys) at -80°C for molecular analyses

This systematic approach ensures reproducible and reliable results when investigating the role of Dpp4 in diabetic complications, particularly diabetic nephropathy .

What analytic techniques provide the most reliable assessment of Dpp4 selectivity for inhibitor screening?

For reliable assessment of Dpp4 inhibitor selectivity, a comprehensive analytical approach using recombinant proteins is recommended:

Recombinant Protein Expression and Purification:

• Express human DPP4, DPP8, and DPP9 proteins in Rosetta cells to ensure proper folding and post-translational modifications

• Purify the recombinant proteins to homogeneity using affinity chromatography followed by size-exclusion chromatography

• Verify protein identity and purity using SDS-PAGE and Western blotting

Enzymatic Activity Assays:

• Establish optimal conditions for each enzyme:

  • Dpp4: Standard conditions with Gly-Pro-AMC substrate

  • Dpp8: Use 30 ng/mL enzyme concentration with 0.2 mmol/L substrate

  • Dpp9: Use 20 ng/mL enzyme concentration with 0.2 mmol/L substrate

• Conduct parallel inhibition assays using identical substrate concentrations and assay conditions

• Generate full dose-response curves for each inhibitor against all three enzymes

Selectivity Index Calculation:

• Calculate IC50 values for each enzyme-inhibitor combination

• Determine the selectivity index as the ratio of IC50 values: SI = IC50(DPP8 or DPP9)/IC50(DPP4)

• Classify inhibitors based on established selectivity thresholds:

  • High selectivity: SI > 1000

  • Moderate selectivity: SI 100-1000

  • Low selectivity: SI < 100

This methodological approach provides a highly reproducible and reliable assessment of inhibitor selectivity, which is crucial for developing safe DPP4 inhibitors without the toxicities associated with DPP8/DPP9 inhibition. Using standardized protein concentrations and substrates ensures consistency across different laboratories and inhibitor screening campaigns .

How can researchers effectively use recombinant rat Dpp4 to investigate glucose metabolism pathways in vitro?

To effectively use recombinant rat Dpp4 for investigating glucose metabolism pathways in vitro, implement a multi-layered experimental approach:

Cell Culture Systems:

• Establish relevant cell lines including rat insulinoma cells (INS-1), hepatocytes, and skeletal muscle cells

• Create experimental conditions mimicking normal and hyperglycemic states (5.5 mM vs 25 mM glucose media)

• Apply recombinant rat Dpp4 (30.7 kDa partial protein) at physiologically relevant concentrations (50-500 ng/mL)

Functional Assays:

• Measure GLP-1 degradation kinetics by incubating active GLP-1 with recombinant Dpp4 and quantifying intact GLP-1 using specific ELISAs at multiple time points

• Assess insulin secretion in INS-1 cells under various conditions:

  • Basal glucose + GLP-1

  • Basal glucose + GLP-1 + recombinant Dpp4

  • High glucose + GLP-1

  • High glucose + GLP-1 + recombinant Dpp4

• Evaluate glucose uptake in skeletal muscle cells using radiolabeled glucose tracers with and without Dpp4 treatment

Molecular Signaling Analysis:

• Examine GLP-1 receptor signaling by measuring cAMP production and PKA activation

• Assess insulin signaling pathway components (IRS-1, PI3K, Akt phosphorylation) via Western blotting

• Investigate AMPK pathway activation, which has been implicated in Dpp4-mediated effects independent of GLP-1

Complementary Approaches:

• Compare results using recombinant Dpp4 with selective Dpp4 inhibitors to confirm specificity

• Include catalytically inactive Dpp4 mutants as controls to distinguish enzymatic vs non-enzymatic effects

• Incorporate siRNA knockdown of Dpp4 receptor binding partners to elucidate specific interaction mechanisms

This systematic approach allows researchers to delineate the precise mechanisms by which Dpp4 influences glucose metabolism pathways, distinguishing direct enzymatic effects from receptor-mediated signaling .

What protocols are recommended for evaluating the effect of Dpp4 on inflammatory processes in diabetic nephropathy models?

For evaluating Dpp4's effects on inflammatory processes in diabetic nephropathy models, the following comprehensive protocol is recommended:

In Vivo Experimental Design:

• Establish four experimental groups:

  • Wild-type control (WT-CON)

  • Wild-type with STZ-induced diabetes (WT-STZ)

  • Dpp4-deficient control (DPP4-def-CON)

  • Dpp4-deficient with STZ-induced diabetes (DPP4-def-STZ)

• Confirm diabetes development through blood glucose monitoring (>300 mg/dL)

• Maintain experimental conditions for at least 42 days after diabetes confirmation

Inflammatory Marker Analysis:

• Tissue Collection and Processing:

  • Harvest kidney tissues and preserve in appropriate conditions (-80°C for molecular studies)

  • Prepare tissue homogenates for protein extraction and RNA isolation

• Gene Expression Analysis (RT-qPCR):

  • Quantify mRNA expression of key inflammatory markers:

    • TNF-α, IL-6, MCP-1 (inflammatory cytokines)

    • TGF-β, fibronectin (fibrotic factors)

    • RAGE (receptor for advanced glycation end-products)

  • Use appropriate reference genes (β-actin or GAPDH) for normalization

• Protein Expression Analysis:

  • Perform Western blotting to quantify protein levels of inflammatory mediators

  • Conduct immunohistochemistry on kidney sections to visualize inflammatory cell infiltration

  • Evaluate NF-κB pathway activation through phospho-specific antibodies

In Vitro Complementary Studies:

• Use rat mesangial cells as a relevant in vitro model

• Expose cells to various conditions:

  • Normal glucose (5.5 mM)

  • High glucose (25 mM)

  • Methylglyoxal (1 mM MGO)

  • Recombinant Dpp4 (500 ng/mL)

  • GLP-1 receptor agonist (Ex-4, 10 nM)

• Measure inflammatory cytokine production using ELISAs for TNF-α, IL-6, and MCP-1

• Assess RAGE expression and AGE formation

Mechanistic Investigations:

• Evaluate the AGE-RAGE signaling axis by measuring:

  • D-lactate levels as a marker of methylglyoxal detoxification

  • GLO-1 expression and activity

  • Nrf-2 nuclear translocation

• Implement siRNA knockdown approaches to confirm the role of specific pathway components

This comprehensive protocol allows for detailed characterization of how Dpp4 influences inflammatory processes in diabetic nephropathy, with particular focus on the connections between Dpp4 activity, GLP-1 signaling, and AGE-RAGE pathway modulation .

What common challenges arise when working with recombinant rat Dpp4 and how can they be addressed?

Several challenges commonly arise when working with recombinant rat Dpp4 in research settings. These challenges and their solutions are presented below:

Protein Stability Issues:

• Challenge: Recombinant Dpp4 may lose enzymatic activity during storage or experimental handling

• Solution: Store the protein in Tris/PBS-based buffer with 5%-50% glycerol at -80°C for long-term storage. For lyophilized preparations, include 6% Trehalose in the buffer before lyophilization. Minimize freeze-thaw cycles by preparing single-use aliquots .

Enzymatic Activity Variability:

• Challenge: Inconsistent enzymatic activity between different protein batches

• Solution: Implement standardized quality control testing for each batch, including specific activity measurements. Use appropriate positive controls and reference standards. Ensure pH and buffer conditions are optimal for Dpp4 activity (typically pH 7.5-8.0) .

Specificity Concerns:

• Challenge: Difficulty distinguishing Dpp4-specific effects from those mediated by related proteases (Dpp8/Dpp9)

• Solution: Include appropriate controls in experimental designs. Use Dpp4-deficient models alongside wild-type controls. When using inhibitors, verify selectivity using the established method with recombinant DPP8 (30 ng/mL) and DPP9 (20 ng/mL) proteins .

N-terminal Tag Interference:

• Challenge: The N-terminal 6xHis-SUMO tag may interfere with certain protein-protein interactions or enzymatic functions

• Solution: Consider tag removal using specific proteases for critical interaction studies. Alternatively, compare results between tagged and tag-cleaved protein versions to identify any tag-dependent effects .

Experimental Design Limitations:

• Challenge: Difficulty translating in vitro findings with recombinant protein to in vivo systems

• Solution: Implement complementary approaches: (1) Compare recombinant protein studies with genetic models (Dpp4-deficient rats), (2) Use cell-based assays as intermediate systems, and (3) Validate key findings across multiple experimental platforms .

By anticipating these challenges and implementing the suggested solutions, researchers can enhance the reliability and reproducibility of their work with recombinant rat Dpp4 protein.

How should researchers interpret contradictory results between in vitro Dpp4 studies and in vivo Dpp4-deficient models?

When faced with contradictory results between in vitro Dpp4 studies and in vivo Dpp4-deficient models, researchers should implement a systematic interpretation framework:

Potential Sources of Discrepancies:

• Compensatory Mechanisms in Genetic Models

  • Dpp4-deficient rats may develop compensatory pathways over time that are absent in acute in vitro settings

  • Solution: Conduct temporal analyses in Dpp4-deficient models to identify developmental adaptations and investigate expression changes in related proteins (Dpp8, Dpp9, FAP)

• Enzymatic vs. Non-enzymatic Functions

  • Recombinant Dpp4 studies typically focus on enzymatic activity, whereas genetic deficiency eliminates both enzymatic and non-enzymatic functions

  • Solution: Use catalytically inactive Dpp4 mutants in vitro to distinguish between these functions

• Concentration and Localization Differences

  • In vitro studies often use non-physiological concentrations of recombinant protein

  • In vivo, Dpp4 exists in both membrane-bound and soluble forms with potentially different functions

  • Solution: Establish dose-response relationships in vitro using physiologically relevant concentrations and separately study membrane vs. soluble forms

Reconciliation Strategies:

• Bridge Studies

  • Implement ex vivo approaches using tissues/cells from Dpp4-deficient rats treated with recombinant Dpp4

  • Compare acute vs. chronic Dpp4 inhibition in wild-type animals

• Comprehensive Pathway Analysis

  • Investigate complete signaling pathways rather than isolated endpoints

  • For example, in studying Dpp4's role in inflammation, examine the entire cascade from GLP-1 stability to AGE formation to RAGE expression to inflammatory cytokine production

• Context Dependency Characterization

  • Systematically vary experimental conditions (glucose concentration, oxidative stress, inflammatory stimuli) to identify context-dependent effects

  • The divergent results might reflect different contextual sensitivities between in vitro and in vivo systems

Reporting Recommendations:

• Acknowledge limitations of both approaches in publications

• Present both concordant and discordant findings transparently

• Develop integrated models that account for complexities of in vivo systems while leveraging mechanistic insights from in vitro work

By applying this structured approach, researchers can transform apparently contradictory results into complementary insights that enhance understanding of Dpp4 biology across different experimental contexts .

What are the most promising future research directions for recombinant rat Dpp4 in metabolic disease models?

The most promising future research directions for recombinant rat Dpp4 in metabolic disease models center on several emerging areas with significant translational potential:

• Tissue-Specific Dpp4 Functions

  • Investigating differential effects of Dpp4 in various tissues (kidney, liver, adipose, vascular endothelium) using tissue-specific conditional knockout models

  • Exploring how recombinant Dpp4 affects organ-specific pathologies in metabolic syndrome

• Beyond GLP-1: Alternative Substrate Pathways

  • Expanding focus to other Dpp4 substrates beyond GLP-1, including GIP, SDF-1α, and neuropeptides

  • Using recombinant Dpp4 to determine substrate preferences and kinetic parameters that may reveal new therapeutic targets

• Dpp4-Microbiome Interactions

  • Exploring how gut microbiota influence Dpp4 expression and activity

  • Investigating whether recombinant Dpp4 alters microbiome composition and metabolite production

• Novel Mechanistic Pathways

  • Further characterizing the connection between Dpp4 and the glyoxalase system in detoxifying reactive metabolites

  • Investigating Dpp4's role in modulating Nrf2-mediated antioxidant responses in various tissues

• Combinatorial Therapeutic Approaches

  • Using recombinant Dpp4 to screen for synergistic effects between Dpp4 inhibition and other therapeutic modalities

  • Developing combination approaches targeting Dpp4 alongside related pathways

• Extracellular Vesicle-Associated Dpp4

  • Investigating the presence and function of Dpp4 in extracellular vesicles

  • Exploring how vesicle-associated Dpp4 contributes to intercellular communication in metabolic diseases

These research directions hold significant promise for advancing our understanding of Dpp4 biology and developing more effective therapeutic strategies for metabolic disorders. By utilizing both recombinant rat Dpp4 for mechanistic studies and Dpp4-deficient models for physiological validation, researchers can develop a comprehensive understanding of this important target in metabolic disease .

What standardized protocols should be adopted by the research community to ensure consistency in Dpp4-related studies?

To ensure consistency and reproducibility in Dpp4-related research, the following standardized protocols should be adopted by the scientific community:

Recombinant Protein Production and Characterization:

• Standardize expression systems (preferably E. coli with N-terminal 6xHis-SUMO tag) for producing recombinant rat Dpp4

• Implement consistent purification protocols achieving >90% purity

• Establish quality control criteria including:

  • SDS-PAGE and Western blot verification

  • Specific activity determination using standardized substrates

  • Stability testing under defined storage conditions

Enzymatic Activity Assays:

• Use standardized substrates at defined concentrations (typically 0.2 mmol/L)

• Perform assays under consistent buffer conditions (Tris/PBS-based, pH 8.0)

• Include appropriate positive and negative controls in each experimental setup

• Report enzyme kinetic parameters (Km, Vmax) alongside activity measurements

In Vivo Model Standardization:

• Use consistent protocols for diabetes induction:

  • STZ administration at 30 mg/kg/day for 3 consecutive days

  • Define diabetes as blood glucose levels >300 mg/dL

• Standardize experimental timelines (minimum 42 days post-diabetes confirmation)

• Include comprehensive phenotyping:

  • Weekly blood glucose measurements

  • HbA1c determination at baseline and endpoint

  • Body weight monitoring

  • Standard panel of kidney function markers

• Collect tissue samples using consistent protocols

Reporting Standards:

• Provide detailed methodological descriptions including:

  • Exact composition of buffers and reagents

  • Specific recombinant protein characteristics (expression region, tags, etc.)

  • Complete experimental timelines and animal housing conditions

• Report both positive and negative results

• Include appropriate statistical analyses with clear descriptions of tests used

Data Sharing:

• Deposit raw data in appropriate repositories

• Share detailed protocols through platforms like protocols.io

• Make plasmids and cell lines available through repositories like Addgene