Recombinant Rat DNA damage-regulated autophagy modulator protein 2 (Dram2)

Shipped with Ice Packs
In Stock

Description

Autophagy Regulation

  • Induction Mechanism: DRAM2 promotes autophagy by increasing LC3-II levels and forming cytoplasmic puncta, similar to its homolog DRAM1 . Silencing DRAM2 disrupts starvation-induced autophagy .

  • Pathway Interactions:

    • Binds BECN1 (Beclin-1) and UVRAG, key components of the PI3K complex regulating autophagosome maturation .

    • Modulates oxidative stress responses via miR-125a targeting, influencing ROS and MDA levels in cardiomyocytes .

Disease Implications

  • Cardioprotection: In myocardial ischemia-reperfusion injury models, DRAM2 inhibition via miR-125a overexpression reduces infarct size and improves cell survival .

  • Retinal Function: Linked to photoreceptor cell renewal, with mutations associated with retinal degeneration .

  • Cancer: Somatic mutations (e.g., p.Ile254Val, p.Arg228Cys) are documented in COSMIC, though their clinical significance remains uncertain .

Experimental Use Cases

  • In Vitro Studies:

    • Luciferase assays confirmed miR-125a directly targets DRAM2’s 3’UTR, modulating autophagy markers (LC3-II, Beclin-1) .

    • Pre-coupled magnetic beads (e.g., DRAM2-1612R-B) enable rapid immunoprecipitation and protein purification .

  • Therapeutic Models:

    • In rat brain injury studies, DRAM2-linked pathways are explored for neuroprotection via autophagy modulation .

Mechanistic Insights

  • Autophagy-Oxidative Stress Axis: DRAM2 knockdown reduces H/R-induced autophagy and oxidative damage in cardiomyocytes by 40–60% .

  • Transcriptional Regulation: p53 upregulates DRAM2 under DNA damage, linking it to tumor suppression pathways .

Mutation Analysis

Pathogenic variants (e.g., frameshift mutation p.Met215fs) are classified as "uncertain significance" but highlight DRAM2’s conserved functional domains .

Future Directions

  • Therapeutic Targeting: DRAM2’s role in miR-125a-mediated cardioprotection suggests potential for RNA-based therapies .

  • Neurological Disorders: Autophagy dysregulation in brain injury models positions DRAM2 as a biomarker for stroke recovery .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Dram2; Tmem77; DNA damage-regulated autophagy modulator protein 2; Transmembrane protein 77
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Dram2
Target Protein Sequence
MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTMPPERCLFGVML NIAAVLGIATIYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSALFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGADIVQKLHWNPEDKGYVLHIVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVTNERTPLLSRDFQ
Uniprot No.

Target Background

Function
Plays a role in the initiation of autophagy. In the retina, it may be involved in the process of photoreceptor cells renewal and recycling to preserve visual function. Induces apoptotic cell death when coexpressed with DRAM1.
Database Links

KEGG: rno:362011

UniGene: Rn.1279

Protein Families
DRAM/TMEM150 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Photoreceptor inner segment. Apical cell membrane.

Q&A

What is the functional role of DRAM2 in cellular processes?

DRAM2 functions primarily at the intersection of DNA damage response and autophagy regulation pathways. Although the precise molecular mechanisms remain under investigation, current evidence suggests DRAM2 becomes activated following DNA damage events and helps maintain cellular homeostasis by regulating autophagic processes.

To investigate DRAM2 function experimentally, researchers should employ knockout or knockdown approaches coupled with cellular stress assays. Studies have demonstrated that exposing DRAM2-deficient human RPE cells to toxic challenges like sodium iodate (NaIO₃) or N-retinylidene-N-retinylethanolamine (A2E) results in increased cell death compared to wild-type cells, suggesting DRAM2 plays a protective role under stress conditions . This approach can be adapted for rat models to understand species-specific functions.

Methodologically, functional studies should include:

  • Generation of DRAM2-deficient models (using CRISPR/Cas9 or shRNA approaches)

  • Exposure to DNA damaging agents or other cellular stressors

  • Assessment of cell viability, autophagy markers, and DNA damage indicators

  • Rescue experiments to confirm phenotype specificity

How can DRAM2 expression be reliably detected in rat tissues?

Multiple complementary approaches can be employed to detect and quantify DRAM2 expression in rat tissues:

  • mRNA expression analysis:

    • Quantitative RT-PCR using rat-specific DRAM2 primers, similar to the approach used in human studies where primers 5′-TCAGCAAGGCCTCAGTTTCC and 5′-GTAGCAATGCATAAAACTGCCG were utilized for DRAM2, with GAPDH as a housekeeping control .

    • RNA-sequencing (bulk or single-cell) to analyze expression patterns across different cell types and tissues.

  • Protein expression analysis:

    • Western blotting using validated antibodies against conserved DRAM2 epitopes

    • Immunohistochemistry for tissue localization studies

    • Flow cytometry for quantification in cell populations

  • In situ hybridization:

    • RNAscope or similar technologies for visualizing DRAM2 mRNA with cellular resolution

    • Particularly useful for heterogeneous tissues with varying expression levels

When designing primers or selecting antibodies, researchers should carefully consider sequence conservation between species. For cross-species studies, focusing on highly conserved regions will improve detection consistency. Additionally, validation with positive and negative controls (e.g., DRAM2 knockout tissues) is essential to confirm specificity of the detection methods.

What is known about the relationship between DRAM2 and DNA damage response pathways?

DRAM2, as its name suggests, is intimately connected to the DNA damage response (DDR) pathway. The DDR pathway involves sensors like the MRN complex (Mre11-Rad50-Nbs1), signal transducers including ATM and ATR kinases, and effectors such as p53, BRCA1, and checkpoint kinases (CHK1, CHK2) . These components detect DNA damage, particularly double-strand breaks, and initiate repair, cell cycle arrest, or apoptosis responses.

While the direct molecular interactions between DRAM2 and core DDR components have not been fully elucidated, several methodological approaches can be used to investigate this relationship:

  • Analyzing DRAM2 expression changes following DNA damage induction using ionizing radiation, radiomimetic drugs, or other genotoxic agents.

  • Examining whether DRAM2 expression/activity depends on key DDR kinases by using specific inhibitors of ATM/ATR or by generating double knockout models.

  • Assessing the impact of DRAM2 deficiency on classical DDR markers such as γH2AX foci formation, ATM/ATR phosphorylation, or p53 activation.

  • Investigating whether DRAM2 influences DNA repair efficiency through comet assays, homologous recombination reporter assays, or non-homologous end joining assays.

The DDR pathway triggers activation of the ATM protein kinase through MRN complex formation, which is essential for DSB repair and genomic stability . Understanding whether DRAM2 functions upstream or downstream of these established DDR components will provide crucial insights into its mechanistic role.

What are the optimal strategies for generating DRAM2 knockout rat models?

Based on current methodologies for generating gene-modified rats, CRISPR/Cas9 technology represents the most efficient approach for creating DRAM2 knockout rat models. Drawing from the literature on knockout generation, the following strategy is recommended:

  • CRISPR/Cas9 design considerations:

    • Target early exons (exons 2-4) to ensure complete functional disruption of the protein. In mouse models, exon 4 of DRAM2 was targeted using CRISPR/Cas9 technology .

    • Design multiple gRNAs and test their cutting efficiency in rat cell lines before in vivo application.

    • Utilize tools that predict off-target effects to select gRNAs with high specificity.

  • Delivery methods:

    • Direct microinjection of CRISPR/Cas9 components into fertilized rat zygotes represents the standard approach.

    • Alternatively, genetically modified spermatogonial stem cells (SSCs) can be created and transplanted into sterile recipients to generate knockout rats, similar to the approach described for other rat knockouts .

  • Validation strategy:

    Validation LevelTechniquesKey Considerations
    Genomic DNAPCR and sequencing of target regionDesign primers flanking the target site
    mRNART-PCR and qPCRConfirm absence of correct transcript
    ProteinWestern blot, immunohistochemistryVerify complete protein loss
    FunctionalCellular stress response assaysTest known DRAM2-dependent phenotypes
  • Colony management:

    • Maintain the line by breeding heterozygotes if the knockout causes significant health issues

    • Consider creating conditional knockouts if constitutive deletion proves lethal

This approach combines lessons from published knockout strategies with current best practices for rat genome editing to maximize success rates.

How do DRAM2 knockout phenotypes compare between in vitro and in vivo models?

Understanding phenotypic differences between in vitro and in vivo DRAM2-deficient models is crucial for comprehensive characterization. Based on available data, several key differences and similarities have been observed:

  • Cellular stress responses:

    • In human in vitro systems, DRAM2 knockout in RPE cells shows increased susceptibility to toxicity-induced cell death when exposed to A2E or sodium iodate .

    • Similar cellular phenotyping should be performed in primary cells isolated from DRAM2 knockout rats to determine if the protective function is conserved across species.

  • Tissue architecture effects:

    • Human retinal organoids with DRAM2 knockout exhibited abnormal cellular composition, including extra mesenchymal cells adjacent to RPE cells .

    • In rat models, comprehensive histological analysis of retinal tissue would be necessary to identify if similar structural changes occur in vivo.

  • Compensatory mechanisms:

    • In vivo models often display compensatory mechanisms that may mask acute phenotypes observed in vitro.

    • Transcriptomic analysis through RNA-seq should be performed in both systems to identify differentially affected pathways and potential compensatory responses.

To systematically compare phenotypes, researchers should design parallel experiments with similar endpoints and experimental conditions. The table below outlines recommended comparative analyses:

Analysis TypeIn Vitro ApproachIn Vivo ApproachComparison Metrics
Cell ViabilityStress-induced death assaysTissue histologyCell death markers
Autophagy FunctionLC3 conversion, flux assaysAutophagosome quantificationAutophagy marker expression
TranscriptomicsRNA-seq of cultured cellsTissue-specific RNA-seqPathway enrichment analysis
Functional Assayse.g., Phagocytosis in RPEElectroretinographyTissue-specific function

This systematic approach will help distinguish between model-specific effects and conserved DRAM2 functions.

What molecular mechanisms underlie DRAM2's role in autophagy regulation following DNA damage?

Elucidating the molecular mechanisms connecting DRAM2, DNA damage, and autophagy requires sophisticated experimental approaches. While the complete mechanism remains to be fully defined, the following methodological strategies can be employed:

  • Protein interaction mapping:

    • Immunoprecipitation followed by mass spectrometry to identify DRAM2-interacting proteins

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to DRAM2

    • Yeast two-hybrid screening to identify direct binding partners

  • Autophagy assessment:

    • Monitor LC3-I to LC3-II conversion by western blotting in DRAM2-deficient versus control cells following DNA damage

    • Use tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) reporters to distinguish between autophagosome formation and lysosomal fusion

    • Electron microscopy for direct visualization of autophagic structures

  • Signaling pathway analysis:

    • Examine phosphorylation status of autophagy regulators (ULK1, AMPK, mTOR) using phospho-specific antibodies

    • Use pathway inhibitors to establish epistatic relationships between DRAM2 and known autophagy regulators

    • Analyze whether DRAM2 deficiency affects p53 activation, as the DNA damage response often involves p53-mediated pathways

Understanding DRAM2's subcellular localization during DNA damage response is also critical, as translocation between cellular compartments could provide clues about its function. Time-course experiments following DNA damage induction would help establish the sequence of events in DRAM2-mediated autophagy regulation.

What validation methods should be used to confirm successful DRAM2 knockout in rat models?

Comprehensive validation of DRAM2 knockout is essential for ensuring experimental reliability. A multi-level validation protocol is recommended:

  • Genomic DNA-level validation:

    • PCR amplification of the targeted region using primers flanking the CRISPR target site, similar to the approach used in human studies (e.g., 5′-ACTTCGTACGCAGTAAGC and 5′-GGCTAAAGTAGGATGAGG) .

    • Cloning PCR products into a T-vector and sequencing multiple clones to identify the exact mutation(s) .

    • For potential large deletions, long-range PCR or Southern blotting may be necessary.

  • mRNA-level validation:

    • Quantitative RT-PCR using primers spanning multiple exons to detect any aberrant splicing.

    • Primers can be designed based on the rat DRAM2 sequence, similar to the approach used in human studies: 5′-TCAGCAAGGCCTCAGTTTCC and 5′-GTAGCAATGCATAAAACTGCCG .

    • Northern blotting to confirm absence of full-length transcript and detect any abnormal transcripts.

  • Protein-level validation:

    • Western blotting using antibodies against different epitopes of DRAM2 to confirm complete protein loss.

    • Immunohistochemistry or immunofluorescence to verify absence of DRAM2 in tissues of interest.

  • Functional validation:

    • Expose cells derived from DRAM2 knockout rats to stressors known to induce DRAM2-dependent responses.

    • In human studies, DRAM2-deficient RPE cells showed increased susceptibility to A2E and sodium iodate , which could serve as functional validation assays in rat models.

  • Off-target analysis:

    • Sequencing of predicted off-target sites to ensure specificity of the genome editing.

    • Whole-genome sequencing for comprehensive off-target detection in founder animals.

This multi-level validation approach ensures that the DRAM2 knockout is complete and specific, providing a solid foundation for subsequent experimental analyses.

How can lentiviral shRNA knockdown approaches be optimized for DRAM2 studies in rat cells?

Lentiviral shRNA knockdown provides a valuable alternative or complement to knockout approaches for studying DRAM2 function. Based on methodologies described in the literature, the following protocol is recommended for rat cells:

  • shRNA design and selection:

    • Design multiple shRNAs targeting different regions of the rat DRAM2 mRNA sequence.

    • Include non-targeting control shRNAs with similar GC content.

    • Commercial shRNAs in lentiviral vectors (e.g., pGIPZ-CMV-tGFP-IRES-puro) can be utilized , but sequence matching to the rat DRAM2 transcript must be confirmed.

  • Lentivirus production:

    • Transfect HEK 293T cells (60-70% confluency) in 10 cm plates with 5 μg of the lentiviral vectors together with packaging plasmids (3.5 μg delta8.9 and 1.7 μg VSVG) using Lipofectamine 2000 .

    • Harvest viral supernatants after 72 hours, filter, determine titer, and store at -80°C.

  • Transduction optimization:

    • Test different MOIs (multiplicity of infection) to determine optimal virus concentration

    • Consider using polybrene (5-8 μg/ml) to enhance transduction efficiency

    • For primary rat cells, which may be harder to transduce, higher MOIs may be necessary

  • Knockdown verification:

    • Use qRT-PCR to quantify DRAM2 mRNA levels as described in human studies

    • Normalize to housekeeping genes (GAPDH, beta-actin) and then to expression in uninfected cells

    • Target at least 70-80% knockdown efficiency for functional studies

  • Experimental timing considerations:

    • Determine the optimal timepoint for experiments post-transduction

    • For stable knockdown, select transduced cells using puromycin selection

The advantage of the knockdown approach is that it allows for studying dose-dependent effects and may avoid compensatory mechanisms that sometimes develop in knockout models.

What are the most suitable cell viability assays for studying DRAM2's role in cellular stress responses?

The literature indicates that DRAM2 plays a protective role against cellular stress, particularly in RPE cells exposed to toxins . To comprehensively assess DRAM2's role in cell survival, multiple complementary assays should be employed:

  • Metabolic activity assays:

    • MTT or MTS assays: Measure mitochondrial activity as an indicator of viable cells

    • ATP-based assays (CellTiter-Glo): Quantify cellular ATP levels as a measure of metabolically active cells

    • Resazurin (Alamar Blue) assays: Provide a fluorescent readout of cellular metabolic activity

  • Membrane integrity assays:

    • Trypan blue exclusion: Quantify cells with intact membranes using automated cell counters

    • LDH release assays: Measure lactate dehydrogenase released from damaged cells

    • Propidium iodide uptake: Assess membrane permeabilization by flow cytometry

  • Apoptosis-specific assays:

    • Annexin V/PI staining: Distinguish between early apoptotic, late apoptotic, and necrotic cells

    • Caspase activity assays: Measure activation of apoptotic caspases (especially caspase 3/7)

    • TUNEL assay: Detect DNA fragmentation associated with apoptosis

  • Real-time monitoring approaches:

    • Impedance-based systems (xCELLigence): Monitor cell growth, morphology, and death continuously

    • Live-cell imaging with death markers: Track individual cell fates over time

    • Caspase activation reporters: Monitor apoptosis induction in real-time

For studying DRAM2's specific role in stress responses, the experimental design should include:

StressorConcentrationExposure TimeKey Readouts
A2E30 μM 24-48 hoursCell viability, apoptosis markers
NaIO₃5 mM 24 hoursCell viability, oxidative stress markers
Ionizing radiation2-10 Gy24-72 hoursDNA damage markers, cell cycle analysis
H₂O₂100-500 μM6-24 hoursOxidative stress response, cell viability

Multiple timepoints should be assessed to distinguish between acute and delayed effects, as DRAM2's role in autophagy may influence long-term survival rather than immediate response to damage.

What statistical approaches are recommended for analyzing differential gene expression in DRAM2-deficient rat models?

Analyzing transcriptomic changes in DRAM2-deficient models requires robust statistical approaches. Based on published methodologies, the following framework is recommended:

  • For bulk RNA-seq analysis:

    • Map sequencing reads to the rat reference genome using established aligners like GSNAP

    • Quantify expression counts per gene using tools like HTSeqGenie

    • Normalize expression counts using "logNormCounts" in scran package and estimate size factors using edgeR

    • Perform differential expression analysis using linear modeling with the voom/limma package

    • Apply appropriate multiple testing corrections (e.g., Benjamini-Hochberg FDR) with significance threshold typically set at adjusted p<0.05

  • For single-cell RNA-seq analysis:

    • Create pseudo-bulk datasets by aggregating cells of each sample from the same cell type using "aggregateAcrossCells" in scran

    • Normalize the resulting pseudo-bulk count matrix and analyze using similar methods as for bulk RNA-seq

    • Perform cell type-specific differential expression analysis to identify cell populations particularly affected by DRAM2 loss

  • Experimental design considerations:

    • Include multiple biological replicates (minimum n=3, preferably n≥5)

    • Account for covariates such as age, sex, and batch effects in the statistical model

    • Consider time-course experiments to capture dynamic changes following DRAM2 loss

  • Validation approaches:

    • Confirm key differentially expressed genes using qRT-PCR

    • Validate protein-level changes for selected candidates

    • Perform pathway analysis to identify biological processes affected by DRAM2 deficiency

This comprehensive statistical framework provides a robust method for analyzing transcriptomic changes in DRAM2-deficient rat models while controlling for false discoveries and technical artifacts.

How can researchers address variability in DRAM2 knockout phenotypes?

Variability in knockout phenotypes is a common challenge in biological research. To address variability in DRAM2 knockout studies, the following methodological approaches are recommended:

  • Generate multiple independent knockout lines:

    • Create and analyze at least two independent knockout lines/clones, similar to the approach used in human studies where two DRAM2 knockout lines (KO1 and KO2) were analyzed

    • This helps distinguish true phenotypes from clone-specific artifacts or off-target effects

  • Control for genetic background effects:

    • Maintain knockout and control animals on identical genetic backgrounds

    • For in vitro studies, generate knockout cells from the same parental line as controls

    • Consider backcrossing knockout rats to establish congenic lines on well-characterized backgrounds

  • Rigorous experimental design:

    • Increase biological replicates to adequately power statistical analyses

    • Include both male and female animals to identify sex-specific effects

    • Standardize environmental conditions (housing, diet, handling) to reduce non-genetic variability

    • Blind experimenters to genotype during data collection and analysis

  • Phenotypic rescue experiments:

    • Re-express wild-type DRAM2 in knockout cells/tissues to confirm that observed phenotypes are specifically due to DRAM2 loss

    • Use multiple independent rescue lines to control for insertion site effects

  • Cross-validation approaches:

    • Complement knockout studies with knockdown approaches (varied efficiency of knockdown can reveal dose-dependent effects)

    • Validate key findings across multiple experimental systems (cell lines, primary cells, in vivo models)

The search results noted variability in shape and size of DRAM2 wild-type and knockout retinal organoids but indicated this was inherent to organoid directed differentiation rather than a specific effect of DRAM2 loss . Distinguishing between technical variability and true biological variability through appropriate controls is crucial.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.