Recombinant Rat DnaJ homolog subfamily C member 14 (Dnajc14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Dnajc14; Drip78; DnaJ homolog subfamily C member 14; Dopamine receptor-interacting protein of 78 kDa; DRiP78
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-703
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Dnajc14
Target Protein Sequence
MAQKHPGERGLCGVHHSGGSSLITSGSSVDPEILSFSGLRDSKETAPNGTRCLKEHSDPK CTQPPNPAHWSDPSHGPPRGPGPPREGGYPDESETCSEESGVDQELSRENETGYQEDGSP SFLPIPSACNCQGSPGVPEGTCSEEGDGSSSSFCHHCTSPALGEDEELEEEYDDEEPLKF PSDFSRVSSGKKPPSRRQRHRFLTKEDVRDSGRRDPKAPGRHRLARKRSQTDKRRGLGLW GVEELCQLGQAGFWWLIELLVLVGEYVETCGYLIYACRKLKGSDLDLFRIWVGVWARRLG GWARVMFQFLSQSFFSVAGLFIRLLRVVGAFLLLALALFLGCLQLGWRFLVGLGDRLGWR GKAAWLFSWLDSPALHHFLTLLKDSRPWQQLVRVIQWGWLELPWVKQRTQRQGTAHVASG RYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDIELKKAYRQLAVMVHPDKNHHPR AEEAFKVLRAAWDIVSNPERRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSR CQGKHRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITE WAGCQRVGISPDTHRVPYHISFGSRVPGTSGRQRATPESPPADLQDFLSRIFQVPPGPMS NGNFFAAPHPGPGTTSTSRPNSSVPKGEAKPKRRKKVRRPFQR
Uniprot No.

Target Background

Function

This protein regulates the trafficking of target proteins, such as DRD1, from the endoplasmic reticulum to the cell membrane.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in heart, brain, lung, liver, skeletal muscle, kidney and testis.

Q&A

Overview

This collection of research-focused FAQs addresses key experimental considerations, methodological approaches, and recent findings regarding Dnajc14. The questions are organized from foundational concepts to advanced research applications, with emphasis on experimental design and critical analysis of current data.

Basic Research Questions

  • What is the basic structure and function of Dnajc14 in rat models?

    Rat Dnajc14 is a 703 amino acid protein belonging to the DnaJ family of heat shock proteins (Hsp40) and functions as a co-chaperone in the HSP70 chaperone machinery. It contains a characteristic J domain that defines DnaJ family membership and facilitates stimulation of ATP hydrolysis when interacting with HSP70 .

    The protein has several key structural features:

    • A J domain essential for HSP70 interaction

    • Multiple potential transmembrane domains

    • A C-terminal domain that mediates self-interaction

    • Two zinc-finger motifs downstream of the J domain

    Functionally, Dnajc14 is involved in protein transport, folding, and quality control within the endoplasmic reticulum . It regulates the export of specific proteins from the endoplasmic reticulum to the cell surface, as demonstrated with dopamine D1 receptors .

  • How does rat Dnajc14 compare structurally to human and other mammalian homologs?

    Rat Dnajc14 shares high sequence homology with other mammalian Dnajc14 proteins. The hamster DNAJC14 is approximately 89% identical and 93% similar to corresponding regions of human DNAJC14 . This conservation suggests functional importance across species.

    To study cross-species functionality:

    1. Perform sequence alignments using tools like BLAST

    2. Generate phylogenetic trees to visualize evolutionary relationships

    3. Conduct complementation assays to test functional interchangeability

    4. Use domain-swapping experiments to identify species-specific functional regions

    Research has demonstrated that human DNAJC14 can functionally substitute for hamster DNAJC14 in viral inhibition assays, indicating conserved functional mechanisms across species .

  • What expression patterns does Dnajc14 exhibit in rat tissues?

    While specific rat tissue expression data is limited in the provided resources, DNAJC14 is known to be expressed in various tissues, with notable expression in neural tissues. To properly characterize expression patterns:

    Methodology for tissue expression profiling:

    1. Quantitative RT-PCR across tissue panels (normalize to housekeeping genes like GAPDH)

    2. Western blotting with Dnajc14-specific antibodies

    3. Immunohistochemistry for tissue localization

    4. RNA-seq for transcriptome-wide comparison across tissues

    Analysis should include temporal considerations (developmental stages) and spatial distribution within tissues of interest. Gene synonyms for database searching include DRIP78, HDJ3, and LIP6 .

Advanced Research Questions

  • What methods are optimal for studying Dnajc14's role in protein quality control mechanisms?

    To investigate Dnajc14's chaperone functions:

    ApproachMethodologyAdvantagesLimitations
    Co-immunoprecipitationUse anti-myc or anti-GFP antibodies to pull down tagged Dnajc14 and identify interacting partnersIdentifies physical interactions in cellular contextMay detect indirect interactions
    ImmunofluorescenceUse specific antibodies for Dnajc14 and potential client proteinsReveals subcellular localization patternsLimited quantitative information
    CRISPR/Cas9 knockoutGenerate Dnajc14-deficient cell linesAllows assessment of necessity for specific functionsMay have compensatory mechanisms
    MutagenesisCreate point mutations in key domains (e.g., J domain or C-terminal domain)Identifies critical residues for functionMay not reveal subtle functional changes

    The optimal approach typically involves multiple complementary methods. For instance, researchers have successfully combined co-immunoprecipitation with immunofluorescence to demonstrate that Dnajc14 physically interacts with client proteins and colocalizes with them in specific cellular compartments .

  • How can researchers effectively study the self-interaction properties of Dnajc14?

    Dnajc14 self-interaction, mediated by its C-terminal 77 amino acids, can be studied through:

    1. Co-immunoprecipitation with differently tagged constructs:

      • Co-express GFP-tagged and myc-tagged Dnajc14 variants

      • Immunoprecipitate with anti-myc antibodies and detect co-purified GFP-tagged proteins

      • Validate with reciprocal immunoprecipitation using anti-GFP antibodies

    2. Förster Resonance Energy Transfer (FRET):

      • Tag Dnajc14 with donor and acceptor fluorophores

      • Measure energy transfer as indicator of proximity

      • Quantify interaction strength under various conditions

    3. Yeast two-hybrid analysis:

      • Create fusion constructs with DNA binding and activation domains

      • Test self-interaction through reporter gene activation

    4. Size exclusion chromatography:

      • Purify recombinant Dnajc14

      • Analyze oligomerization state

    Research has shown that deletion of the C-terminal 77 amino acids abolishes self-interaction while maintaining J-domain functionality, providing a valuable negative control for interaction studies .

  • What are the experimental considerations when investigating Dnajc14's role in flavivirus replication?

    DNAJC14 has a complex relationship with flavivirus replication, requiring careful experimental design:

    1. Expression level considerations:

      • Overexpression inhibits flavivirus replication

      • Endogenous levels may be required for optimal viral replication complex formation

      • Use inducible expression systems to titrate levels precisely

    2. Time-course experiments:

      • DNAJC14-mediated inhibition is time-dependent

      • Early viral translation remains unaffected

      • RNA replication is the primary inhibited step

    3. Localization studies:

      • Use confocal microscopy with dsRNA markers to identify viral replication complexes

      • Track endogenous DNAJC14 redistribution during infection

      • Non-inhibitory DNAJC14 mutants can serve as tools to visualize recruitment to replication complexes

    4. Functional assays:

      • Use replicon systems expressing luciferase to distinguish effects on entry versus replication

      • Compare wildtype and polymerase-defective (ΔDD) replicons to separate translation from replication effects

    The apparent paradox that both silencing and overexpression of DNAJC14 can inhibit viral replication suggests a critical "sweet spot" for optimal stoichiometry in replication complex formation .

  • How does Dnajc14's relationship with viral replication differ between virus families?

    Dnajc14 exhibits striking differences in its relationship with different virus families:

    Virus FamilyMemberDNAJC14 RequirementEffect of OverexpressionMechanism
    Flaviviridae (Flavivirus)Yellow Fever VirusRequired at endogenous levelsInhibitoryAffects RNA replication step
    Flaviviridae (Flavivirus)Kunjin, LangatRequired at endogenous levelsInhibitorySimilar to YFV
    Flaviviridae (Hepacivirus)Hepatitis C VirusRequired at endogenous levelsInhibitorySimilar to YFV
    Flaviviridae (Pestivirus)Classical Swine Fever VirusEssential cofactorCytopathic effectActivates NS2 autoprotease
    Flaviviridae (Pestivirus)Atypical Porcine PestivirusNot requiredNo effectDNAJC14-independent NS2-3 processing

    This differential relationship represents a fascinating evolutionary divergence within the Flaviviridae family. To investigate these differences:

    1. Conduct comparative proteomics of viral replication complexes

    2. Perform domain-swapping experiments between viral proteins

    3. Use DNAJC14 knockout cell lines for complementation studies

    4. Identify alternative cellular cofactors in APPV replication

    The finding that APPV can replicate in DNAJC14 knockout cells while CSFV cannot represents a significant divergence in the pestivirus genus .

  • What techniques are recommended for studying the interaction between Dnajc14 and viral nonstructural proteins?

    To investigate Dnajc14-viral protein interactions:

    1. Co-immunoprecipitation with controls:

      • Use non-inhibitory Dnajc14 mutants (e.g., CT1) to avoid confounding effects on viral replication

      • Include appropriate cellular markers (e.g., calnexin) as negative controls

      • Validate with reciprocal immunoprecipitations

    2. Proximity labeling approaches:

      • BioID or APEX2 fusion proteins to identify neighboring proteins

      • TurboID for faster labeling kinetics

      • Mass spectrometry analysis of labeled proteins

    3. Super-resolution microscopy:

      • Track co-localization dynamics during infection progression

      • Combine with fluorescence recovery after photobleaching (FRAP) to assess mobility

    4. In vitro binding assays:

      • Purify recombinant proteins or domains

      • Surface plasmon resonance or isothermal titration calorimetry for binding kinetics

      • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    Research has demonstrated that even non-inhibitory DNAJC14 mutants physically interact with viral NS3 protein but not with control ER proteins like calnexin .

  • What are the key considerations when using DNAJC14 knockout or silencing approaches?

    When manipulating DNAJC14 expression:

    1. Consider knockout effect variability:

      • DNAJC14 knockout prevents replication of most pestiviruses

      • APPV uniquely replicates independently of DNAJC14

      • Flaviviruses show impaired replication upon DNAJC14 silencing

    2. Technical considerations for effective silencing:

      • Validate knockdown efficiency by qRT-PCR and Western blotting

      • Account for low endogenous expression levels (typically >1000-fold lower than housekeeping genes like GAPDH)

      • Use at least 60 nM siRNA concentration with appropriate transfection reagents

      • Consider repeated transfections to maintain silencing

    3. Rescue experiments:

      • Include siRNA-resistant expression constructs

      • Use inducible expression systems to control timing

      • Test structure-function relationships with mutant constructs

    4. Readout optimization:

      • Combine viral titer measurements with intracellular replication markers

      • Use time-course experiments to distinguish early from late effects

      • Account for potential compensatory mechanisms

    Research shows that approximately 2-fold reduction in DNAJC14 mRNA can result in 4-fold reduction in viral titers, indicating sensitive dependence on expression levels .

  • How can researchers distinguish between direct and indirect effects of Dnajc14 on protein trafficking?

    Distinguishing direct from indirect effects requires rigorous controls:

    1. Structure-function analysis:

      • Generate comprehensive mutation series targeting specific domains

      • Identify separation-of-function mutants that affect specific interactions

      • Test C-terminal deletions that abolish self-interaction but maintain other functions

    2. Temporal control systems:

      • Use drug-inducible expression systems

      • Employ optogenetic tools for acute activation/inactivation

      • Analyze rapid-response pathways versus delayed secondary effects

    3. Biochemical fractionation:

      • Isolate membrane fractions at different time points

      • Track client protein progression through cellular compartments

      • Combine with glycosylation analysis to monitor ER-to-Golgi transit

    4. Trafficking pathway disruption:

      • Use Brefeldin A to block conventional ER-to-Golgi transport

      • Test for unconventional secretion pathways under stress conditions

      • Compare effects on multiple cargo proteins

    Research demonstrates that Dnajc14 can mediate unconventional trafficking of misfolded proteins through Hsc70-dependent mechanisms, highlighting its role in protein quality control beyond conventional secretory pathways .

  • What methods are most effective for studying the J-domain functionality of Dnajc14?

    The J-domain is crucial for Dnajc14 function and can be studied through:

    1. Point mutagenesis of key residues:

      • Create H→Q mutations in the HPD motif that abolish Hsp70 interaction

      • Test functional consequences in cellular assays

      • Compare with known J-domain mutations from other family members

    2. Chimeric protein approaches:

      • Swap the J-domain with those from other DNAJ proteins

      • Test functional complementation

      • Identify specificity determinants

    3. In vitro ATPase assays:

      • Measure stimulation of Hsp70 ATPase activity

      • Compare wildtype versus mutant J-domains

      • Determine kinetic parameters and binding affinities

    4. Structural studies:

      • Solve NMR or crystal structures of isolated domains

      • Perform molecular dynamics simulations

      • Map interaction surfaces with Hsp70

    The J-domain of Dnajc14 is essential for its function in multiple contexts, including regulation of dopamine receptor trafficking and modulation of viral replication .

  • What are the emerging techniques for studying Dnajc14's role in unconventional protein secretion pathways?

    To investigate Dnajc14's role in unconventional secretion:

    1. ER stress induction models:

      • Chemical ER stressors (tunicamycin, thapsigargin)

      • Monitor Dnajc14-dependent trafficking under stress conditions

      • Track UPR marker correlation with Dnajc14 activity

    2. Live-cell imaging approaches:

      • Fluorescently tagged cargo proteins

      • Photoactivatable reporters to track specific protein cohorts

      • Quantitative colocalization analysis

    3. Proteomics strategies:

      • Quantitative cell surface proteomics with/without Dnajc14 manipulation

      • Secretome analysis under ER stress conditions

      • SILAC or TMT labeling for comparative studies

    4. Genetic interaction mapping:

      • CRISPR screens for modifiers of Dnajc14 function

      • Synthetic lethality/sickness analysis

      • Epistasis testing with UPR components

    Research has revealed that Dnajc14 and Hsc70 cooperatively mediate Golgi-independent cell surface expression of certain misfolded proteins, suggesting therapeutic potential for protein misfolding diseases such as Pendred syndrome .

Data Tables and Relevant Research Findings

Table 1: Key Dnajc14 Structural Domains and Their Functions

DomainPositionFunctionEffect of Deletion/MutationReference
J-domainN-terminal regionInteraction with Hsp70; stimulation of ATPase activityLoss of chaperone function
Transmembrane domainsMultiple potential regionsMembrane anchoring and topologyAffects cellular localization but not necessarily function
C-terminal domainLast 77 amino acidsSelf-interaction; dimerizationLoss of self-interaction; abolishes antiviral activity
Zinc-finger motifsDownstream of J-domainPotential substrate bindingNot fully characterized

Table 2: Comparison of Dnajc14 Effects on Different Viral Family Members

VirusFamily/GenusEffect of DNAJC14 KnockoutEffect of DNAJC14 OverexpressionMechanismReference
Yellow Fever VirusFlaviviridae/FlavivirusImpaired replicationInhibits replicationAffects RNA replication complex
KunjinFlaviviridae/FlavivirusSimilar to YFVInhibits replicationSimilar to YFV
LangatFlaviviridae/FlavivirusSimilar to YFVInhibits replicationSimilar to YFV
Hepatitis C VirusFlaviviridae/HepacivirusSimilar to YFVInhibits replicationSimilar to YFV
CSFVFlaviviridae/PestivirusNo replicationCytopathic effectControls NS2-3 cleavage
APPVFlaviviridae/PestivirusNormal replicationNo effectDNAJC14-independent NS2-3 processing

Table 3: Methodological Approaches for Dnajc14 Functional Analysis

TechniqueApplicationKey ControlsConsiderationsReference
RNAi silencingLoss-of-functionNon-targeting siRNA; qPCR validationLow endogenous expression requires sensitive detection
CRISPR/Cas9 knockoutComplete loss-of-functionParental cell line; complementationMay reveal differential requirements for various processes
OverexpressionGain-of-function; dominant-negative effectsEmpty vector; titrated expressionMay disrupt optimal stoichiometry
Co-immunoprecipitationProtein-protein interactionsIgG control; irrelevant proteinsDetergent conditions affect membrane protein interactions
MutagenesisStructure-function analysisConservative vs. non-conservative mutationsTarget evolutionary conserved residues
Viral repliconsSeparating viral lifecycle stagesReplication-defective controlsAllows focus on specific replication steps

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.