Recombinant Rat DnaJ homolog subfamily C member 22 (Dnajc22)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rat Dnajc22 is synthesized using multiple expression systems:

Expression Platforms

SystemPurityTag Options
Cell-Free Expression≥85% None
E. coli≥85% His, GST, Fc
Mammalian Cells (HEK293)≥90% His, Avi

Role as a Co-Chaperone

  • Facilitates Hsp70’s ATPase activity during substrate binding .

  • Interacts with mitochondrial GrpE homologs (Grpel1/Grpel2) to regulate Hsp70-substrate interactions .

Pathway Involvement

Pathway ComponentPartner Proteins
Protein foldingDnajc7, Dnajc13
Mitochondrial importGrpel1, Hspa4

Subcellular Localization

  • Integral membrane protein, active in membrane-associated processes .

Research Applications

Key Tools

  • ELISA Kits: Detect native (non-recombinant) Dnajc22 in body fluids/tissue homogenates .

  • Antibody Blocking: Recombinant protein (e.g., PA5-65250 control fragment) used to validate antibody specificity .

Experimental Use Cases

  • Immunoprecipitation: Identified interactions with Hsp70 family members (Hspa4, Hsph1) .

  • Structural Studies: Full-length recombinant protein aids in mapping transmembrane domains .

Challenges and Future Directions

  • Functional Redundancy: Overlap with other DnaJ proteins (e.g., Dnajc7) complicates mechanistic studies .

  • Therapeutic Potential: Membrane localization suggests roles in stress-response diseases, warranting further in vivo validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Dnajc22; DnaJ homolog subfamily C member 22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Dnajc22
Target Protein Sequence
MAKGLLMTYALWAFGGPVGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQAN GVQSWKQRPEEERPPLSLLRFASQMVVGVYFGLVALISLSSTANFYIVGLPLAVGLGVLL VAAVGNQTSDFKNTLGAAFLTSPVFYGRPIAILPISLAASITAQKHRRYKVSAVSETLSV RLYRVGLAYLAFTGPLAYSTLYNTAATINYAAETLGSFLSWFNFFPLLGRLVESVLLLPC RIWWLLVGAPGFNSSQFQEWEKLYEFVDSFQDEKRQLAHQVLGIPEGATNEEIHRSYRDL VKVWHPDHNRHQTEEAQRHFLEIQAAYEVLSQPKKPRASWR
Uniprot No.

Target Background

Function

May function as a co-chaperone.

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dnajc22 and what is known about its evolutionary conservation?

Dnajc22 (DnaJ heat shock protein family (Hsp40) member C22) is a vertebrate ortholog of Drosophila melanogaster Wurst, a gene that plays an essential role in the functional development of the fly's tracheal system (respiratory organ) . This protein is highly conserved with single orthologs across multiple species, including humans, rats, zebrafish, and fruitflies, suggesting important biological functions . Despite this conservation, there has been limited functional characterization of Dnajc22 in vertebrates until recently, with most research focusing on its transcriptional regulation rather than specific functions .

How is Dnajc22 gene expression regulated at the transcriptional level?

Dnajc22 expression is primarily regulated by the transcription factor Hnf4a (Hepatocyte Nuclear Factor 4 alpha). This regulatory relationship was identified through a comprehensive approach combining computational biology and experimental validation . The methodology involved:

  • Self-organizing map (SOM) clustering to identify genes co-expressed with Dnajc22

  • Prediction of transcription factor binding using algorithms like iRegulon and pcaGoPromoter

  • Analysis of correlation coefficients between potential transcription factors and Dnajc22

  • Validation of binding sites using ChIP-qPCR and luciferase assays

This Hnf4a-mediated regulation of Dnajc22 has been verified across multiple species, demonstrating evolutionary conservation of this regulatory mechanism in fruitfly, zebrafish, and humans .

What are the typical purity levels of commercially available Recombinant Rat Dnajc22?

Commercially available Recombinant Rat Dnajc22 typically has a purity level of greater than or equal to 85% as determined by SDS-PAGE analysis . This applies to both full-length recombinant protein and partial recombinant proteins. The proteins are typically produced using various expression systems, including cell-free expression systems, E. coli, yeast, baculovirus, or mammalian cell expression systems . Researchers should verify the purity level and expression system when selecting recombinant Dnajc22 for experiments to ensure compatibility with their specific research applications.

How can one experimentally validate potential transcriptional regulators of Dnajc22?

Validating transcriptional regulators of Dnajc22 requires a multi-step approach combining bioinformatics prediction with experimental validation. Based on the successful identification of Hnf4a as a regulator, the following methodology is recommended:

  • Bioinformatic prediction phase:

    • Perform co-expression analysis across tissue atlases to identify co-expressed transcription factors

    • Use binding site prediction algorithms (TFBIND, PROMO, MATCH) to identify potential binding sites

    • Evaluate publicly available ChIP-seq datasets for candidate transcription factors

  • Experimental validation phase:

    • ChIP-qPCR to confirm binding of the transcription factor to the Dnajc22 locus

    • Luciferase reporter assays using the Dnajc22 promoter region

    • Site-directed mutagenesis of predicted binding sites to identify functional elements

    • Analysis of Dnajc22 expression in transcription factor knockout or knockdown models

This integrated approach significantly reduces experimental time by leveraging publicly available genomic information before conducting targeted wet-lab validation .

What methodologies are recommended for studying Dnajc22 across different species?

Studying Dnajc22 across species requires consideration of evolutionary conservation and species-specific differences. Based on research approaches documented in the literature, the following methodology is recommended:

  • Sequence analysis:

    • Identify orthologs across species using sequence alignment tools

    • Analyze conservation of protein domains and regulatory elements

  • Expression analysis:

    • Quantify expression patterns across different tissues using RT-qPCR or RNA-seq

    • Compare expression profiles between species to identify conserved patterns

  • Functional studies:

    • Utilize model organisms (e.g., fruitfly, zebrafish) for loss-of-function studies

    • Implement CRISPR-Cas9 mediated knockout or knockdown approaches

    • Perform complementation studies across species

  • Regulatory mechanism investigation:

    • Examine conservation of transcription factor binding sites

    • Validate regulatory relationships experimentally in each species of interest

This cross-species approach has successfully demonstrated that the Hnf4a-Dnajc22 regulatory relationship is conserved from fruitflies to humans, suggesting important functional roles .

How can RNA isolation protocols be optimized for studying Dnajc22 expression in adipose tissue?

RNA isolation from adipose tissue for studying Dnajc22 expression requires specific methodological considerations due to the high fat content. Based on protocols used in transcriptomic studies, the following optimized methodology is recommended:

  • Tissue collection and processing:

    • Collect approximately 200 mg of adipose tissue

    • Process immediately in 2 ml of TRI Reagent buffer using a gentle tissue dissociator (e.g., MACS dissociator)

  • Fat removal (critical step):

    • Incubate processed samples at room temperature for 5 minutes

    • Centrifuge at 12,000 g at 4°C for 10 minutes

    • Carefully remove the fat monolayer before proceeding

  • RNA extraction:

    • Collect the supernatant and add 200 μl of chloroform

    • Vortex thoroughly and centrifuge at 12,000 g at 4°C for 30 minutes

    • Collect the upper aqueous phase and repeat the chloroform extraction

    • Mix the final RNA-containing phase with 1.5 volumes of 100% ethanol

  • Quality control:

    • Assess RNA purity using spectrophotometry (A260/A280 ratio)

    • Verify RNA integrity using bioanalyzer or gel electrophoresis

    • Plot distribution of expression levels to identify and remove lowly expressed genes

This optimized protocol ensures high-quality RNA suitable for downstream applications such as RT-qPCR or RNA-seq analysis of Dnajc22 expression patterns.

What cell lines are appropriate for studying Dnajc22 function and regulation?

Selecting appropriate cell lines for studying Dnajc22 requires consideration of endogenous expression levels and the research question being addressed. Based on published literature, the following approach is recommended:

  • For regulation studies:

    • Kidney cell lines (e.g., murine M-1) with low endogenous Hnf4a expression are ideal for controlled studies of Dnajc22 regulation

    • These systems allow for heterologous expression of transcription factors to study regulatory mechanisms

  • For functional studies:

    • Select cell lines based on natural Dnajc22 expression patterns

    • Consider cell lines derived from tissues with high Dnajc22 expression (kidney, liver)

    • For knockout studies, choose lines with moderate to high endogenous expression

  • Expression validation:

    • Before proceeding with experiments, validate the expression level of Dnajc22 in selected cell lines using RT-qPCR

    • Verify expression of relevant transcription factors (particularly Hnf4a)

  • Transfection efficiency considerations:

    • Assess transfection efficiency for each cell line when planning overexpression or knockdown studies

    • Optimize transfection protocols based on cell type-specific requirements

This strategic selection of cell lines provides a controlled experimental system for investigating both the regulation and function of Dnajc22.

What experimental controls should be included when studying Hnf4a-mediated regulation of Dnajc22?

Proper experimental controls are critical for accurate interpretation of results when studying Hnf4a-mediated regulation of Dnajc22. Based on validated approaches, the following controls should be included:

  • For ChIP-qPCR experiments:

    • Input control (non-immunoprecipitated chromatin)

    • IgG control (non-specific antibody)

    • Positive control (known Hnf4a target gene)

    • Negative control (genomic region without predicted Hnf4a binding sites)

  • For luciferase reporter assays:

    • Empty vector control (no promoter)

    • Minimal promoter without Dnajc22 regulatory elements

    • Positive control promoter (known Hnf4a-responsive promoter)

    • Site-directed mutagenesis controls for each predicted binding site

  • For expression studies:

    • Vehicle control for treatment conditions

    • Scrambled siRNA for knockdown experiments

    • Empty expression vector for overexpression studies

    • Housekeeping gene controls for normalization of expression data

  • For cross-species validation:

    • Species-specific negative controls

    • Orthologous gene controls to verify conservation of regulatory mechanisms

The inclusion of these comprehensive controls ensures robust and reproducible results when investigating the Hnf4a-Dnajc22 regulatory relationship .

How should one interpret Dnajc22 expression data across different tissues and species?

Interpreting Dnajc22 expression data requires consideration of tissue-specific patterns and cross-species differences. Based on established approaches, the following methodology is recommended:

This comprehensive approach enables robust interpretation of Dnajc22 expression data, facilitating the identification of conserved patterns that may indicate functional importance .

What bioinformatic approaches can be used to predict potential functions of Dnajc22?

Given the limited functional characterization of Dnajc22, bioinformatic approaches can provide valuable insights into potential functions. Based on successful computational strategies, the following methodology is recommended:

  • Sequence-based analysis:

    • Identify conserved domains through multiple sequence alignment

    • Predict protein structure using homology modeling

    • Analyze potential post-translational modifications

  • Co-expression analysis:

    • Perform SOM-clustering across diverse transcriptomic datasets

    • Identify genes consistently co-expressed with Dnajc22

    • Conduct Gene Ontology enrichment analysis of co-expressed genes

  • Network analysis:

    • Construct protein-protein interaction networks

    • Identify pathway enrichment for potential interacting partners

    • Perform transcription factor enrichment analysis

  • Cross-species functional inference:

    • Leverage functional data from Drosophila Wurst studies

    • Analyze phenotypic data from model organisms with Dnajc22 mutations

    • Utilize synteny analysis to identify conserved genomic neighborhoods

This integrated bioinformatic approach can generate testable hypotheses about Dnajc22 function, particularly in relation to its role in the DnaJ heat shock protein family and potential involvement in developmental processes .

What are the promising approaches for characterizing the function of Dnajc22 in vertebrates?

Understanding the function of Dnajc22 in vertebrates represents a significant knowledge gap. Based on current literature and research approaches, the following methodologies are recommended:

  • Genetic manipulation strategies:

    • Generate conditional knockout models in mice

    • Develop tissue-specific knockouts to circumvent potential embryonic lethality

    • Utilize CRISPR-Cas9 for precise genomic editing

  • Proteomic approaches:

    • Perform immunoprecipitation followed by mass spectrometry to identify interacting partners

    • Use BioID or APEX proximity labeling to map the protein interaction landscape

    • Investigate post-translational modifications affecting function

  • Developmental studies:

    • Analyze expression patterns during embryonic development

    • Investigate potential roles in organogenesis, particularly in tissues with high expression

    • Examine potential conservation of function with Drosophila Wurst in respiratory/tubular development

  • Disease relevance investigation:

    • Analyze expression in disease states, particularly in tissues with high Dnajc22 expression

    • Investigate genetic associations with human diseases

    • Explore potential roles in stress response pathways typical of heat shock proteins

These approaches would significantly advance our understanding of Dnajc22 function in vertebrates, building upon the relatively limited knowledge currently available .

How might the Hnf4a-Dnajc22 regulatory relationship contribute to disease mechanisms?

The identification of Hnf4a as a key regulator of Dnajc22 suggests potential implications for disease mechanisms, particularly in tissues where both are highly expressed. Based on current knowledge, the following research directions are recommended:

  • Metabolic disease investigation:

    • Analyze Dnajc22 expression in metabolic disorders where Hnf4a is dysregulated

    • Investigate potential roles in diabetes, given Hnf4a's established role in pancreatic function

    • Examine correlations between Dnajc22 expression and metabolic parameters

  • Cancer relevance:

    • Analyze expression patterns in cancer types where Hnf4a is implicated (e.g., hepatocellular carcinoma)

    • Investigate potential tumor suppressor or oncogenic functions

    • Examine prognostic value of Dnajc22 expression in relevant cancer types

  • Inflammatory conditions:

    • Study the relationship between inflammatory signaling, Hnf4a activity, and Dnajc22 expression

    • Investigate potential roles in inflammatory bowel disease or other inflammatory conditions

    • Examine effects of anti-inflammatory treatments on the Hnf4a-Dnajc22 axis

  • Therapeutic targeting potential:

    • Explore the possibility of modulating Dnajc22 expression through Hnf4a-targeted therapies

    • Investigate small molecule compounds that could affect this regulatory relationship

    • Assess potential off-target effects of existing Hnf4a-targeting therapeutic approaches

This focused research on disease relevance could reveal important pathophysiological roles for the Hnf4a-Dnajc22 axis and potentially identify new therapeutic targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.