Recombinant Rat DnaJ homolog subfamily C member 25 (Dnajc25)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat DnaJ Homolog Subfamily C Member 25 (Dnajc25)

DnaJ homolog subfamily C member 25 (DNAJC25) is a protein belonging to the DnaJ/Hsp40 family of heat shock proteins . These proteins are involved in various cellular processes, primarily protein folding . DNAJC25 is predicted to be located in the endoplasmic reticulum membrane and play a role in protein folding .

Genomic Context and Genetic Diversity

The gene encoding DNAJC25 is found in both humans and rats . Studies utilizing the rat reference genome have facilitated the discovery of genetic diversity in laboratory rats, which is crucial for understanding the genetic basis of various traits and diseases . A revamped rat reference genome, mRatBN7.2, has improved the discovery of genetic diversity in laboratory rats . Whole-genome sequencing of 163 samples from 88 inbred strains and 32 substrains led to the identification of 15,804,627 high-quality sites .

Expression Analysis in Breast Cancer

DNAJC25 has been identified as a candidate tumor suppressor gene in breast cancer . Its expression levels vary in different breast cancer cell lines .

  • Differential Expression: DNAJC25 mRNA levels are significantly reduced in the MDA-MB-231 (claudin-low, triple-negative) breast cancer cell line compared to the non-tumorigenic mammary epithelial cell line MCF 10A . Conversely, BT-20 (basal, triple-negative) and ZR-75-1 (luminal, ER+) cell lines show significantly higher levels of DNAJC25 mRNA .

  • Clinical Samples: Analysis using the UALCAN in-silico tool revealed that DNAJC25 mRNA expression is reduced in clinical breast cancer samples compared to normal samples . Specifically, HER2+ and Triple-Negative Breast Cancer (TNBC) clinical tumor samples have significantly lower levels of DNAJC25 mRNA compared to normal samples .

Prognostic Value in Breast Cancer

High DNAJC25 expression correlates with favorable post-progression survival in breast cancer patients .

Epigenetic Alterations

The DNAJC25 promoter region is hypomethylated in breast cell lines and clinical samples . Combined bisulfite restriction analysis (COBRA) results showed that the DNAJC25 promoter is not methylated in breast cell lines . Promoter hypomethylation was also observed in normal and tumor clinical samples .

Role in T Cell Receptor Diversity

The diversity of the T cell receptor (TCR) β-chain repertoire is enhanced by the arrangement of D-J-C gene clusters . The presence of three D-J-C clusters increases the number of D and J genes available for somatic recombination .

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped on standard blue ice packs. Dry ice shipping is available upon request with an additional fee. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type will be determined during production. If you require a specific tag type, please inform us; we will prioritize its inclusion.

Synonyms
Dnajc25; DnaJ homolog subfamily C member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Dnajc25
Target Protein Sequence
MAARLAWRRGPGAAGQRPWLLLAPLLLVPLLVRPAEALVEGLYCGTRDCYEVLGVSRSAS KAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEETRKDYDYM LDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISVFQYFSWWNSYNKSISYLATVPK YRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRD LLLFQVLLAPVHLCSYIAWYCRWVYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDH QKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Uniprot No.

Target Background

Database Links
Protein Families
DNAJC25 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is recombinant Dnajc25 typically prepared for research applications?

Recombinant Rat Dnajc25 protein is typically prepared through the following methodological approach:

  • Gene cloning: The full-length coding sequence (CDS) is amplified using PCR with specific primers designed at exon boundaries (e.g., 5′-TGAGTGCTGCAGAATCGCTGG-3′ and 5′-AAGGTTTGGCATAGTAGCATTCCATC-3′) .

  • Vector construction: The amplified product is inserted into an expression vector (e.g., pMD18-T, pCMV-Myc, pcDNA3.1A(-), or pEGFP-N1) for sequencing and expression .

  • Expression system: The protein can be expressed in various systems including yeast, E. coli, or mammalian cells depending on research requirements .

  • Purification: Typically purified using affinity chromatography with tags such as His-tag .

  • Storage: Optimally stored in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage. Working aliquots can be stored at 4°C for up to one week .

What is the tissue distribution pattern of Dnajc25 expression?

Dnajc25 shows distinct tissue distribution patterns with notably high expression in certain organs:

TissueRelative Expression Level
LiverHigh
TestisModerate
KidneyModerate
BrainLow
HeartLow

Research using RT-PCR analysis with human multiple tissue cDNA (MTC) panels has revealed that DNAJC25 expression is particularly high in liver tissues compared to other organs, which has implications for its potential role in hepatocellular carcinogenesis .

How can I effectively design expression studies for Dnajc25 in cancer models?

When designing expression studies for Dnajc25 in cancer models, consider the following methodological approach:

  • Selection of appropriate cell lines: Use both normal cell lines (e.g., MCF 10A for breast studies) and cancer cell lines (e.g., Hep3B, SMMC-7721 for liver cancer; BT-20, ZR-75-1, MDA-MB-231 for breast cancer) .

  • Expression vector construction:

    • Clone the full-length Dnajc25 into appropriate expression vectors (e.g., pcDNA3.1A(-) for stable expression)

    • Include appropriate tags (e.g., Myc, His, or GFP) for detection and localization studies

  • Transfection optimization:

    • Optimize transfection conditions for each cell line

    • Include proper controls (empty vector transfections)

    • Verify expression by Western blot, qRT-PCR, or immunofluorescence

  • Functional assays:

    • Colony formation assay to assess effects on cell growth

    • Flow cytometry for cell cycle and apoptosis analysis

    • Cell proliferation assays (e.g., MTT or CellTiter-Glo)

  • Data analysis: Compare Dnajc25 expression levels in tumor versus normal tissues or cells, and correlate with phenotypic changes in functional assays .

A study on hepatocellular carcinoma demonstrated that overexpression of DNAJC25 led to a 74.67% reduction in colony formation for Hep3B cells (P<0.001) and 79.00% for SMMC-7721 cells (P<0.05), suggesting its tumor suppressive properties .

What are the recommended conditions for storage and handling of recombinant Dnajc25?

For optimal results when working with recombinant Dnajc25, follow these evidence-based storage and handling recommendations:

  • Short-term storage: Store at -20°C in Tris-based buffer with 50% glycerol optimized for protein stability.

  • Long-term storage: Store at -20°C to -80°C in single-use aliquots to avoid repeated freeze-thaw cycles.

  • Working aliquots: Can be stored at 4°C for up to one week.

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • Buffer conditions: Tris-based buffer with 50% glycerol, pH 7.5-8.0. The specific formulation should be optimized for the particular protein preparation .

  • Handling during experiments: Maintain on ice when in use and return to appropriate storage conditions promptly after experiments.

These recommendations are based on standard protocols for recombinant proteins to maintain structural integrity and biological activity .

How does Dnajc25 function as a potential tumor suppressor in hepatocellular carcinoma?

Dnajc25 has demonstrated tumor suppressor properties in hepatocellular carcinoma (HCC) through multiple mechanisms:

  • Downregulation in cancer tissues: DNAJC25 expression is significantly reduced in HCC tissues compared to adjacent normal liver tissues, suggesting a tumor-suppressive role .

  • Proapoptotic activity: Flow cytometry analysis revealed that overexpression of DNAJC25 significantly increases cell apoptosis:

    • In Hep3B cells: The sub-G1 ratio (apoptotic cells) increased from 13.23% in controls to 18.80% in DNAJC25-transfected cells (P<0.001)

    • In HEK 293 cells: The sub-G1 ratio increased from 3.92% in controls to 16.41% in DNAJC25-transfected cells (P<0.05)

  • Inhibition of colony formation: DNAJC25 overexpression markedly reduced both the number and size of surviving colonies in HCC cell lines:

    • 74.67% reduction in Hep3B cells (P<0.001)

    • 79.00% reduction in SMMC-7721 cells (P<0.05)

  • Cell cycle effects: Unlike other tumor suppressors, DNAJC25 does not appear to induce cell cycle arrest, suggesting its primary mechanism is through inducing apoptosis .

These findings indicate that DNAJC25 functions as a tumor suppressor primarily through its proapoptotic properties, which is notably different from many other heat shock proteins (such as HSP27 and HSP70) that are typically upregulated in tumors and have antiapoptotic properties .

What techniques can be used to study the interaction between Dnajc25 and HSP70 chaperones?

To investigate the molecular interactions between Dnajc25 and HSP70 chaperones, researchers can employ these advanced techniques:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of Dnajc25 (e.g., His-tagged) and HSP70

    • Precipitate one protein using antibody-bound beads

    • Detect co-precipitated partner by Western blot

    • Controls should include precipitations with non-specific antibodies and lysates lacking expression of one partner

  • Proximity Ligation Assay (PLA):

    • Allows visualization of protein interactions in situ

    • Uses antibodies against both Dnajc25 and HSP70

    • Interaction produces fluorescent signal when proteins are within 40 nm

    • Provides spatial information about where interactions occur within cells

  • Surface Plasmon Resonance (SPR):

    • Quantitatively measures binding kinetics and affinity

    • Immobilize purified Dnajc25 on a sensor chip

    • Flow HSP70 over the surface in varying concentrations

    • Measure association and dissociation rates

  • ATPase Assay:

    • Since J-domain proteins stimulate the ATPase activity of HSP70

    • Measure ATP hydrolysis rates of HSP70 in presence/absence of Dnajc25

    • Analyze using malachite green phosphate detection or radioactive ATP

  • Yeast Two-Hybrid System:

    • Clone Dnajc25 into bait vector and HSP70 into prey vector

    • Co-transform into yeast

    • Assess interaction through reporter gene activation

These approaches can be employed in combination to provide complementary data about the physical and functional interactions between Dnajc25 and HSP70 chaperones.

What is the significance of Dnajc25 expression changes in cancer progression and patient prognosis?

The expression patterns of Dnajc25 have significant implications for cancer progression and patient outcomes:

  • Differential expression in cancer types:

    • Hepatocellular carcinoma: Significantly downregulated compared to normal liver tissues, suggesting tumor suppressor function

    • Breast cancer: Clinical breast cancer samples show reduced DNAJC25 mRNA levels compared to normal samples (P=1.47e-02)

  • Prognostic value:

    • Breast cancer: High DNAJC25 expression is favorable for post-progression survival (P=0.0035)

    • Multiple cancer types: Unlike many other HSPs that are associated with poor outcomes, DNAJC25 overexpression correlates with favorable prognosis in several cancers

  • Survival correlation analysis:
    The table below summarizes survival correlations across cancer types:

    Cancer TypeSurvival Impact of High DNAJC25 ExpressionP-value
    Breast CancerFavorable for post-progression survival0.0035
    Adrenocortical carcinomaFavorableSignificant
    Kidney ChromophobeFavorableSignificant
    Uterine CarcinosarcomaFavorableSignificant
    Skin Cutaneous MelanomaUnfavorableSignificant
    Acute Myeloid LeukemiaUnfavorableSignificant
  • Molecular subtype correlations:

    • In breast cancer, decreased expression of DNAJC25 is associated with ER-negative and HER2-negative tumors, suggesting correlation with more aggressive basal breast cancer subtypes

  • Genetic and epigenetic regulation:

    • Point mutations and copy number variations of DNAJC25 are uncommon in clinical breast cancer samples

    • Promoter hypomethylation is observed in both normal and tumor clinical samples (Beta-value<0.25), indicating expression regulation occurs through other mechanisms

This evidence collectively supports DNAJC25 as a potential prognostic biomarker and tumor suppressor, with its downregulation potentially contributing to cancer progression in specific tumor types .

How can I troubleshoot low expression or activity of recombinant Dnajc25 in experimental systems?

When experiencing low expression or activity of recombinant Dnajc25, consider this systematic troubleshooting approach:

  • Expression system optimization:

    • Try different expression systems (E. coli, yeast, mammalian cells)

    • Yeast systems have shown good results for Dnajc25 expression with >90% purity

    • Consider codon optimization for the host organism

  • Vector design considerations:

    • Test different promoters (constitutive vs. inducible)

    • Optimize Kozak sequence for improved translation initiation

    • Evaluate different tags (His, GST, MBP) for enhanced solubility and detection

    • Position tags at N- or C-terminus to determine optimal orientation

  • Protein solubility enhancement:

    • Lower induction temperature (16-20°C) for slower expression

    • Co-express with chaperones to assist proper folding

    • Add solubility enhancers (e.g., sorbitol, arginine) to lysis and purification buffers

  • Activity assessment considerations:

    • Ensure proper J-domain folding using circular dichroism

    • Verify protein integrity by mass spectrometry

    • Test functionality through ATPase stimulation assays with HSP70

  • Purification strategy improvements:

    • Optimize buffer conditions (pH, salt concentration, reducing agents)

    • Include stabilizers (glycerol, specific ions) in purification buffers

    • Use gentle elution conditions to preserve protein structure

    • Consider on-column refolding for proteins expressed in inclusion bodies

  • Storage optimization:

    • Aliquot at appropriate concentrations to avoid freeze-thaw cycles

    • Test different stabilizers (glycerol, sucrose, BSA) for long-term storage

    • Store in Tris-based buffer with 50% glycerol as recommended

Following this systematic approach will help identify and resolve specific issues affecting recombinant Dnajc25 expression and activity.

What are the most effective gene silencing approaches for studying Dnajc25 function?

For effective gene silencing of Dnajc25, researchers should consider these methodological approaches with their respective advantages and limitations:

  • siRNA-mediated knockdown:

    • Design: Target conserved regions of Dnajc25 mRNA; design 2-3 siRNAs targeting different regions

    • Delivery: Lipid-based transfection for cell lines; electroporation for harder-to-transfect cells

    • Validation: Confirm knockdown by qRT-PCR and Western blot 48-72 hours post-transfection

    • Advantages: Rapid, cost-effective, easy to implement

    • Limitations: Transient effect (3-7 days), potential off-target effects

  • shRNA-mediated stable knockdown:

    • Design: Convert effective siRNA sequences into shRNA format with appropriate loop structure

    • Delivery: Lentiviral or retroviral vectors for stable integration

    • Selection: Apply antibiotic selection (puromycin, G418) to obtain stable cell lines

    • Advantages: Long-term knockdown, suitable for in vivo studies

    • Limitations: Time-consuming to establish stable lines, potential integration site effects

  • CRISPR-Cas9 gene knockout:

    • Design: sgRNAs targeting early exons of Dnajc25; multiple guides recommended

    • Validation: Sequence verification of edits, Western blot confirmation of protein loss

    • Screening: Single-cell cloning and screening to identify complete knockouts

    • Advantages: Complete protein elimination, permanent modification

    • Limitations: Potential developmental compensation, time-intensive screening process

  • Inducible knockdown systems:

    • Systems: Tet-on/Tet-off for temporal control of shRNA expression

    • Implementation: Generate stable lines with doxycycline-inducible shRNA

    • Advantages: Temporal control, useful for developmental studies

    • Limitations: System leakiness, additional complexity in experimental design

  • Rescue experiments:

    • Essential for validating specificity of observed phenotypes

    • Express siRNA/shRNA-resistant Dnajc25 variants (with silent mutations)

    • Should restore normal phenotype if effects are specific to Dnajc25 loss

For Dnajc25 specifically, researchers should be aware of its potential tumor suppressor function when designing experiments, as knockdown may enhance proliferation in certain cell types, as suggested by studies showing reduced expression in hepatocellular carcinoma and breast cancer .

How can I accurately measure the impact of Dnajc25 on cell apoptosis in cancer models?

To accurately measure the impact of Dnajc25 on apoptosis in cancer models, implement these methodological approaches:

  • Flow cytometry-based methods:

    • Annexin V/PI staining: Distinguishes early apoptotic (Annexin V+/PI-) from late apoptotic (Annexin V+/PI+) and necrotic cells

    • Sub-G1 peak analysis: Identifies cells with fragmented DNA, as demonstrated in studies where Dnajc25 overexpression increased sub-G1 population from 13.23% to 18.80% in Hep3B cells (P<0.001)

    • TUNEL assay: Detects DNA fragmentation by labeling DNA breaks

  • Protein marker analysis by Western blotting:

    • Caspase activation: Measure cleaved caspases (especially caspase-3, -8, -9)

    • PARP cleavage: Examine 89 kDa PARP fragment as indicator of apoptosis

    • Bcl-2 family proteins: Monitor changes in pro-apoptotic (Bax, Bad) and anti-apoptotic (Bcl-2, Bcl-xL) proteins

  • Microscopy-based methods:

    • Immunofluorescence: Visualize apoptotic markers and morphological changes

    • Live-cell imaging: Track cell death in real-time using fluorescent reporters

    • Electron microscopy: Observe ultrastructural changes characteristic of apoptosis

  • Gene expression analysis:

    • qRT-PCR: Measure expression changes in apoptosis-related genes

    • RNA-seq: Perform genome-wide transcriptome analysis to identify affected pathways

    • PCR arrays: Use focused arrays for apoptosis pathway genes

  • Functional assays:

    • Caspase activity assays: Measure enzymatic activity using fluorogenic substrates

    • Mitochondrial membrane potential: Assess using JC-1 or TMRE dyes

    • Cytochrome c release: Analyze by subcellular fractionation and immunoblotting

  • Experimental design considerations:

    • Controls: Include both positive controls (known apoptosis inducers) and negative controls

    • Time course: Measure at multiple time points (24h, 48h, 72h) to capture dynamics

    • Dose-response: Test different expression levels of Dnajc25

    • Cell lines: Use multiple cancer cell lines to ensure reproducibility

    • Combinatorial approaches: Combine Dnajc25 modulation with apoptosis inducers/inhibitors

This comprehensive approach has been validated in studies demonstrating DNAJC25's proapoptotic effects in hepatocellular carcinoma cells, where flow cytometry successfully measured increased sub-G1 populations in both Hep3B and HEK 293 cells following DNAJC25 overexpression .

What are the current gaps in understanding Dnajc25's molecular mechanisms in cancer suppression?

Despite emerging evidence for Dnajc25's tumor suppressive properties, several significant knowledge gaps remain:

  • Downstream signaling pathways:

    • The precise molecular pathways through which Dnajc25 induces apoptosis remain undefined

    • The direct targets of Dnajc25 in its proapoptotic function are unknown

    • How Dnajc25 interacts with established apoptotic machinery (intrinsic vs. extrinsic pathways) requires investigation

  • HSP70 interaction specificity:

    • While Dnajc25 belongs to the HSP40 family that typically interacts with HSP70 proteins, the specific HSP70 partner(s) for Dnajc25 have not been identified

    • Whether Dnajc25's tumor suppressive function is dependent on its co-chaperone activity or represents a distinct function remains unclear

  • Regulatory mechanisms:

    • Factors controlling Dnajc25 expression in normal and cancer cells are poorly understood

    • While promoter hypomethylation has been observed in breast cancer, the mechanisms responsible for reduced expression in tumors remain elusive

    • Whether post-translational modifications regulate Dnajc25 function is unknown

  • Tissue-specific roles:

    • Why Dnajc25 shows particularly high expression in liver compared to other tissues requires explanation

    • The contradictory prognostic associations across different cancer types (favorable in some, unfavorable in others) need investigation

  • Therapeutic potential:

    • The feasibility of targeting Dnajc25 pathways for cancer therapy has not been explored

    • Potential synthetic lethal interactions with Dnajc25 downregulation that could be therapeutically exploited remain undiscovered

These knowledge gaps represent important opportunities for future research to fully elucidate Dnajc25's role in cancer biology and potentially develop novel therapeutic approaches based on its tumor suppressive properties.

How might Dnajc25 interact with other heat shock proteins in stress response and disease contexts?

The potential interactions between Dnajc25 and other heat shock proteins in stress response and disease contexts represent a complex network with significant implications:

  • HSP70 family interactions:

    • As a J-domain protein, Dnajc25 likely interacts with specific HSP70 family members

    • These interactions may be context-dependent, varying between normal physiology and disease states

    • Understanding which specific HSP70 proteins partner with Dnajc25 could reveal tissue-specific functions

  • Competitive or cooperative interactions with other HSP40 proteins:

    • The human genome encodes over 40 DNAJ proteins classified into types A, B, and C

    • Dnajc25 may compete with other DNAJ proteins for binding to HSP70 chaperones

    • Different combinations of HSP70-DNAJ pairs likely recognize distinct substrate proteins

  • Stress response dynamics:

    • Studies in Japanese flounder have shown that Dnajc25 expression is influenced by stress conditions

    • Dnajc25 expression was affected by experimental treatments across multiple time points, suggesting dynamic regulation in response to stress

    • The temporal pattern of Dnajc25 expression relative to other heat shock proteins during stress remains to be fully characterized

  • Protein quality control networks:

    • Dnajc25 likely participates in broader protein quality control networks involving multiple chaperone systems

    • Potential interactions with HSP90 complexes, which have been associated with poor prognosis in cancer, could reveal antagonistic relationships between different chaperone systems

  • Disease-specific interactions:

    • The opposing roles of Dnajc25 (tumor suppressive) versus HSP90 and some HSP70 proteins (oncogenic) suggest potential antagonistic relationships in cancer contexts

    • This contradicts the conventional understanding of coordinated heat shock protein responses and warrants further investigation

  • Therapeutic implications:

    • Understanding the interplay between Dnajc25 and other heat shock proteins could reveal novel therapeutic approaches

    • Targeting specific HSP interactions rather than individual proteins might provide more precise therapeutic strategies with fewer side effects

Future research employing proteomics approaches like BioID, proximity labeling, or comprehensive co-immunoprecipitation studies could map the Dnajc25 interactome across different physiological and disease conditions.

What emerging technologies could advance our understanding of Dnajc25's role in cellular function and disease?

Several cutting-edge technologies hold promise for deepening our understanding of Dnajc25's biological functions:

  • CRISPR-based technologies:

    • CRISPRi/CRISPRa: For precise modulation of Dnajc25 expression without genetic modification

    • CRISPR screens: To identify synthetic lethal interactions and pathways influenced by Dnajc25

    • Base editing: For introducing specific point mutations to study structure-function relationships

    • Prime editing: For precise genetic modifications to study regulatory elements controlling Dnajc25 expression

  • Advanced protein interaction technologies:

    • Proximity labeling (BioID, APEX): To identify the complete Dnajc25 interactome in living cells

    • Cross-linking mass spectrometry: For capturing transient protein interactions

    • Single-molecule FRET: To visualize Dnajc25-client interactions in real-time

    • Cryo-electron microscopy: To resolve Dnajc25 structure and its complexes with partner proteins

  • Spatial transcriptomics and proteomics:

    • Spatial transcriptomics: To map Dnajc25 expression patterns within tissues with subcellular resolution

    • Imaging mass cytometry: To simultaneously visualize multiple proteins and their modifications

    • Super-resolution microscopy: To study Dnajc25 localization and dynamics at nanoscale resolution

  • Single-cell technologies:

    • Single-cell RNA-seq: To identify cell populations with differential Dnajc25 expression

    • Single-cell proteomics: To correlate Dnajc25 protein levels with cellular phenotypes

    • Multi-omics integration: To connect Dnajc25 expression with epigenetic, transcriptomic, and proteomic data

  • Organoid and advanced disease models:

    • Patient-derived organoids: To study Dnajc25 function in physiologically relevant 3D systems

    • Organ-on-chip technologies: To examine Dnajc25 in complex tissue microenvironments

    • Humanized mouse models: For studying Dnajc25 in immune-cancer interactions

  • AI and computational approaches:

    • Deep learning: For predicting Dnajc25 protein interactions and functional domains

    • Network analysis: To position Dnajc25 within protein interaction networks and signaling pathways

    • Molecular dynamics simulations: To understand Dnajc25 conformational changes during client binding

These technologies could help resolve the apparent contradiction between Dnajc25's role as a tumor suppressor and the traditionally pro-survival functions of many heat shock proteins, potentially revealing novel therapeutic strategies for cancers where Dnajc25 is dysregulated .

How can we reconcile contradictory findings about Dnajc25 expression patterns across different cancer types?

The apparently contradictory findings regarding Dnajc25 expression and its prognostic significance across cancer types can be reconciled through several methodological and biological considerations:

  • Tissue-specific baseline expression:

    • Dnajc25 shows markedly high expression in normal liver tissue

    • Differential baseline expression across tissues may influence the functional impact of expression changes in cancer

  • Cancer type-specific roles:

    • Survival analysis using PRECOG (PREdiction of Clinical Outcomes from Genomic Profiles) revealed:

      • Favorable prognosis (survival Z-score < 0) associated with high DNAJC25 expression in breast, adrenocortical, kidney, and uterine cancers

      • Poor prognosis (survival Z-score > 0) associated with high DNAJC25 expression in melanoma, leukemia, and lung cancers

    • This suggests context-dependent functions rather than a universal role

  • Molecular subtype considerations:

    • In breast cancer, DNAJC25 downregulation correlates with ER-negative and HER2-negative status, suggesting subtype-specific patterns

    • Studies should stratify results by molecular subtypes within each cancer type

  • Methodological differences:

    • Discrepancies may arise from different detection methods (qRT-PCR, microarray, RNA-seq)

    • Threshold definitions for "high" versus "low" expression vary between studies

    • Reference genes or normalization methods may influence relative expression calculations

  • Functional context:

    • HSPs often show seemingly contradictory behaviors depending on cellular context

    • DNAJC25's apparent tumor suppressive role contradicts the general oncogenic role of many other HSPs, suggesting unique functions

    • The ratio between DNAJC25 and other interacting proteins may be more important than absolute levels

To address these contradictions, future studies should:

  • Employ multiple detection methods with standardized thresholds

  • Include large cohorts stratified by molecular subtypes

  • Consider relative expression compared to tissue-matched controls

  • Examine co-expression patterns with potential interacting partners

  • Validate findings through functional studies in appropriate model systems

This comprehensive approach would help clarify whether Dnajc25 truly has opposing roles in different cancers or whether methodological differences account for apparent contradictions.

What explains the unusual role of Dnajc25 as a potential tumor suppressor when many heat shock proteins act as oncogenes?

The paradoxical role of Dnajc25 as a tumor suppressor, contrary to the oncogenic functions of many other heat shock proteins, can be explained by several molecular and functional hypotheses:

This apparent contradiction actually provides valuable insight into the functional diversity within the heat shock protein family and highlights the need to avoid generalizations about HSP functions. As noted in research: "Our description of both the downregulated expression of DNAJC25 in HCC and its proapoptotic function is opposite to the previous findings of certain other HSPs, such as HSP27 and HSP70, which have been reported to be upregulated in tumors and have antiapoptotic properties" .

Future research using proteomics approaches to identify Dnajc25-specific client proteins and signaling partners will be crucial for fully understanding this unique role.

How can Dnajc25 research contribute to cancer biomarker development and therapeutic strategies?

Dnajc25 research offers promising applications for cancer diagnostics, prognostics, and therapeutic development:

  • Diagnostic biomarker potential:

    • Tissue-specific applications: Particularly relevant for liver cancers given high baseline Dnajc25 expression in normal liver tissue

    • Expression analysis in biopsies: Reduced Dnajc25 expression could help distinguish cancerous from normal tissue

    • Liquid biopsy development: Exploring whether Dnajc25 or its regulated genes are detectable in circulating tumor DNA or exosomes

  • Prognostic biomarker applications:

    • Survival prediction: High Dnajc25 expression correlates with favorable prognosis in breast cancer (P=0.0035 for post-progression survival)

    • Multi-marker panels: Combining Dnajc25 with other HSPs (HSP90AA1, CCT1, CCT2, CCT6A) in predictive models

    • Molecular subtyping: Potential role in classifying tumors, as its expression correlates with ER/HER2 status in breast cancer

  • Therapeutic strategies:

    • Gene therapy approaches: Restoring Dnajc25 expression in cancers where it is downregulated

    • Small molecule screening: Identifying compounds that induce Dnajc25 expression or mimic its proapoptotic function

    • Synthetic lethality: Exploiting vulnerabilities created by Dnajc25 downregulation

    • Combination therapies: Enhancing efficacy of existing treatments by modulating Dnajc25 activity

  • Drug response prediction:

    • Chemotherapy sensitivity: Investigating whether Dnajc25 expression levels predict response to specific treatments

    • Resistance mechanisms: Studying whether Dnajc25 downregulation contributes to therapy resistance

  • Target identification and validation workflow:

    PhaseMethodsExpected Outcomes
    DiscoveryExpression analysis in clinical samplesIdentification of cancer types with significant Dnajc25 dysregulation
    MechanismFunctional studies in cell lines and animal modelsValidation of causative role in cancer progression
    Biomarker validationRetrospective and prospective clinical studiesDetermination of sensitivity/specificity in diagnostic applications
    Therapeutic developmentSmall molecule screening, gene therapy approachesIdentification of compounds or vectors for clinical development

Research has demonstrated DNAJC25's potential as both a biomarker and therapeutic target: "Our data, therefore, indicate that DNAJC25 plays an important role in hepatocellular carcinogenesis, and should be further studied as a potential tumor suppressor candidate" . This opens promising avenues for translational research that could eventually impact clinical practice.

What are the most appropriate animal models for studying Dnajc25 function in vivo?

Selecting appropriate animal models for in vivo Dnajc25 research requires careful consideration of species-specific characteristics and disease relevance:

  • Rodent models:

    • Advantages: Well-characterized genetics, relatively inexpensive, short generation time

    • Applications:

      • Dnajc25 knockout mice to study systemic effects of gene loss

      • Conditional knockout models for tissue-specific deletion

      • Xenograft models using human cancer cells with modulated Dnajc25 expression

    • Considerations: Rat Dnajc25 has been well-characterized with known sequence and expression patterns

  • Aquatic models:

    • Japanese flounder: Extensively studied Dnajc25 expression patterns in response to stress and infection

    • Applications: Studying Dnajc25 in immune response and stress adaptation

    • Findings: Dnajc25 expression in Japanese flounder was influenced by experimental treatments across multiple time points and tissues

    • Advantages: Useful for evolutionary studies and stress response research

  • Cancer-specific models:

    • Hepatocellular carcinoma models:

      • Chemically-induced (DEN) liver cancer in mice or rats

      • Genetically engineered models (MYC, RAS, or P53 mutations)

      • Hydrodynamic tail vein injection for liver-specific gene delivery

    • Breast cancer models:

      • MMTV-PyMT or MMTV-Neu transgenic mice

      • 4T1 orthotopic models in immunocompetent mice

      • Patient-derived xenografts in immunocompromised mice

  • Novel approach considerations:

    • Humanized mice: To study Dnajc25 in human immune contexts

    • CRISPR-engineered models: For precise genomic modifications

    • Patient-derived organoids: For testing Dnajc25 modulation in human tissues

    • Ex vivo tissue culture: For intermediate complexity between cell culture and in vivo models

  • Selection criteria based on research questions:

    Research QuestionRecommended ModelRationale
    Basic Dnajc25 functionConventional knockout miceReveals systemic effects of gene loss
    Tissue-specific rolesConditional knockout miceAvoids developmental effects, targets specific tissues
    Therapeutic testingXenograft or PDX modelsClosely mimics human tumors, allows preclinical drug testing
    Stress responseJapanese flounder or stress-challenge rodent modelsEstablished systems for studying heat shock responses
    Developmental rolesZebrafish or knockout miceTransparent embryos or well-characterized development

When designing in vivo studies, researchers should consider that Dnajc25 may have different roles across tissues and developmental stages, as evidenced by its varied prognostic associations in different cancer types . The model should be matched to the specific aspect of Dnajc25 biology under investigation.

What are the key takeaways for researchers beginning work with Recombinant Rat Dnajc25?

For researchers initiating studies with Recombinant Rat DnaJ homolog subfamily C member 25 (Dnajc25), these key points should guide experimental design and interpretation:

  • Protein characteristics and handling:

    • Recombinant Rat Dnajc25 is a 357 amino acid protein with a full-length sequence available for reference

    • Optimal storage conditions include -20°C to -80°C in Tris-based buffer with 50% glycerol

    • Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

  • Expression patterns and significance:

    • Dnajc25 shows notably high expression in liver tissues compared to other organs

    • Expression is significantly downregulated in hepatocellular carcinoma and breast cancer

    • This pattern contrasts with many other heat shock proteins that are upregulated in cancer

  • Functional implications:

    • Evidence supports a tumor suppressor role, particularly through promoting apoptosis

    • Overexpression significantly reduces colony formation and increases sub-G1 (apoptotic) cell populations

    • Unlike many heat shock proteins with oncogenic properties, Dnajc25 demonstrates tumor-suppressive functions

  • Experimental approaches:

    • Colony formation assays and flow cytometry are validated methods for studying Dnajc25's effects on cell growth and apoptosis

    • When designing expression studies, include appropriate controls and verify expression using Western blot, qRT-PCR, or immunofluorescence

    • Consider both gain-of-function (overexpression) and loss-of-function (knockdown/knockout) approaches

  • Translational potential:

    • High expression correlates with favorable prognosis in breast cancer and other cancer types

    • Low expression is associated with more aggressive cancer subtypes

    • Potential applications include biomarker development and therapeutic targeting

  • Current limitations:

    • Precise molecular mechanisms and signaling pathways remain incompletely understood

    • The specific HSP70 partners and client proteins for Dnajc25 require further characterization

    • The apparent contradiction with general HSP functions warrants mechanistic investigation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.