Recombinant Rat Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Rpn2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rpn2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit; Ribophorin II; RPN-II; Ribophorin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-631
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
LTPTHYLTKHDVERLKASLDRPFTSLESAFYSIVGLNSLGAQVPDVKKACAFIKSNLDPS NVDSLFYAAQSSQVLSGCEISVSNETRDLLLAAVSEDSSVAQIYHAVAALSGFGLPLASH EALGALTARLSKEETVLATVQALHTASHLSQQADLRNIVEEIEDLVARLDELGGVYLQFE EGLELTALFVAATYKLMDHVGTEPSIKEDQVIQLMNTIFSKKNFESLSEAFSVASAAAAL SQNRYHVPVVVVPEGSASDTQEQAILRLQVSSVLSQPLAQAAVKLEHAKSVASRATVLQK MPFSLVGDVFELNFKNVKLPSGYYDFSVRVEGDNRYIANTVELRVKISTEVGITNVDLST VDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQK TGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVV IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIR IGANVSNFTFAPSTVIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAVLGTVTFLAGNRMLA QQAVKRTAH
Uniprot No.

Target Background

Function
This protein is a subunit of the oligosaccharyltransferase (OST) complex. The OST complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in N-glycosylation. N-glycosylation occurs co-translationally, and the complex interacts with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are necessary for optimal enzyme activity.
Database Links

KEGG: rno:64701

STRING: 10116.ENSRNOP00000063207

UniGene: Rn.2879

Protein Families
SWP1 family
Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.