Recombinant Rat Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (Dad1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

Dad1 is a 113-amino acid protein (11–13 kDa) encoded by the Dad1 gene (UniProt ID: P61805) . It functions as a non-catalytic subunit of the oligosaccharyltransferase (OST) complex, which transfers preassembled oligosaccharides to asparagine residues in nascent polypeptides . Key structural and functional attributes include:

PropertyDetail
Domain StructureSingle-pass transmembrane protein with luminal/extracellular orientation
Key InteractionsBinds MCL1 to regulate apoptosis ; stabilizes OST complex integrity
Enzymatic RoleEssential for OST activity, facilitating N-glycosylation
Conserved MotifsContains ER-targeting sequences and glycosylation recognition domains

Dad1’s role in apoptosis was identified in temperature-sensitive tsBN7 cells, where its depletion triggers programmed cell death . This dual functionality links glycosylation fidelity to cellular survival mechanisms.

Recombinant Expression Systems

Recombinant Dad1 is produced using bacterial (E. coli) or yeast expression systems, with purification facilitated by affinity tags. Common variants include:

Role in Glycosylation and Disease

  • OST Complex Assembly: Dad1 stabilizes the OST complex, enabling glycosylation of ~50% of eukaryotic proteins . Mutations disrupt glycosylation, leading to congenital disorders (e.g., CDG1R) .

  • Apoptosis Regulation: Overexpression in hepatocellular carcinoma correlates with tumor progression, suggesting oncogenic potential .

Biomedical Assays

Commercial ELISA kits (e.g., Assay Genie RTEB1363, MyBioSource MBS7249166) detect Dad1 in rat serum/plasma with sensitivities ≤0.159 ng/mL . Key parameters:

KitDetection RangeSensitivitySample Types
RTEB13630.312–20 ng/mL0.159 ng/mLSerum, plasma, tissue homogenates
MBS724916678–5000 pg/mL30 pg/mLCell culture supernatants

Future Directions

Current research focuses on:

  1. Therapeutic Targeting: Inhibiting Dad1 in glycosylation-dependent cancers .

  2. Structural Biology: Cryo-EM studies to resolve OST complex dynamics .

  3. Gene Editing: CRISPR models to dissect Dad1’s role in developmental disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance for arrangement and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Dad1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-113
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Uniprot No.

Target Background

Function
DAD1 is a subunit of the oligosaccharyl transferase (OST) complex, which catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process marks the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the OST complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity.
Database Links
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of DAD1 in cellular processes?

DAD1, the defender against apoptotic cell death, functions as an essential subunit of the oligosaccharyltransferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2) from the lipid carrier dolichol-pyrophosphate to asparagine residues within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, representing the first critical step in protein N-glycosylation . This process occurs cotranslationally as the OST complex associates with the Sec61 complex at the channel-forming translocon that mediates protein translocation across the endoplasmic reticulum membrane . Additionally, DAD1 was initially identified as a negative regulator of programmed cell death, with studies demonstrating that loss of the DAD1 protein triggers apoptosis, highlighting its dual role in glycosylation and cell survival .

How does the structure of rat DAD1 compare to human and other mammalian orthologs?

The rat DAD1 protein shares remarkable sequence conservation with its mammalian orthologs. The N-terminal region (amino acids 1-28) of rat DAD1 exhibits 100% sequence identity with the corresponding regions in both mouse and human DAD1 proteins . This high degree of conservation underscores the evolutionary importance of DAD1's function across mammalian species. The full-length DAD1 protein is approximately 12.5 kDa in size and contains multiple membrane-spanning domains that anchor it within the endoplasmic reticulum membrane . The protein's topology includes alternating cytoplasmic and lumenal domains with three helical transmembrane segments (amino acids 31-51, 53-73, and 93-113), allowing it to integrate properly within the OST complex .

What is the relationship between DAD1 and the oligosaccharyltransferase complex?

DAD1 serves as a core structural and functional subunit of the oligosaccharyltransferase (OST) complex, present in roughly equimolar amounts relative to other subunits . Biochemical analyses using sedimentation velocity studies of detergent-solubilized cells and canine rough microsomes have confirmed that DAD1 co-sediments precisely with OST activity and with other OST components such as ribophorin I, ribophorin II, and OST48 . Cross-linking experiments using dithiobis(succinimidylpropionate) have demonstrated that DAD1 physically associates with OST48 in intact microsomes, and can form heterotrimers with ribophorin II and OST48, as well as heterotetramers with ribophorin I, ribophorin II, and OST48 . This tight association persists throughout purification procedures, indicating that DAD1 is required for maintaining the structural integrity of the OST complex .

What are the optimal conditions for using recombinant DAD1 control fragments in blocking experiments?

When conducting blocking experiments with recombinant DAD1 control fragments (such as the amino acids 1-28 fragment), researchers should use a 100x molar excess of the protein fragment control relative to the corresponding antibody concentration . The optimal protocol involves pre-incubating the antibody-protein control fragment mixture for 30 minutes at room temperature before application in experimental procedures . This approach is particularly effective for validating antibody specificity in immunohistochemistry/immunocytochemistry (IHC/ICC) and Western blot (WB) experiments. Researchers should calculate the required amount of control fragment based on both the concentration and molecular weight of the antibody being used to ensure proper stoichiometry in the blocking reaction .

How can researchers effectively isolate and purify functional DAD1 from recombinant expression systems?

The purification of recombinant DAD1 presents challenges due to its hydrophobic nature and tight association with other OST complex components. A successful protocol involves:

  • Expression in a suitable system (bacterial or mammalian cells depending on research needs)

  • Membrane fraction isolation using differential centrifugation

  • Solubilization with appropriate detergents (typically digitonin or Triton X-100)

  • Affinity chromatography using tagged recombinant constructs

  • Size exclusion chromatography for final purification

When isolating DAD1 as part of the intact OST complex, it's important to note that DAD1 may not be easily detected by Coomassie blue staining due to its poor staining properties, necessitating protein immunoblot confirmation during purification steps . The interaction between DAD1 and other OST subunits remains stable throughout purification, suggesting that these associations are not labile under typical isolation conditions . For structural and functional studies, maintaining the native conformation of DAD1 within its membrane environment is crucial.

What experimental approaches can distinguish between DAD1's roles in glycosylation versus apoptosis regulation?

To differentiate between DAD1's dual functions, researchers can employ the following experimental strategies:

Experimental ApproachGlycosylation Function AssessmentApoptosis Regulation Assessment
Temperature-sensitive mutantsMonitor N-glycosylation defects via glycoprotein analysisMeasure apoptotic markers at non-permissive temperatures
Site-directed mutagenesisIdentify residues critical for OST activityDetermine regions essential for cell survival independent of glycosylation
Inducible knockdown/knockoutQuantify changes in glycosylation patternsAssess temporal relationship between glycosylation defects and apoptosis onset
Rescue experimentsComplement with wild-type or mutant DAD1Test if glycosylation-defective mutants can still prevent apoptosis
Domain-specific inhibitorsBlock specific functional domainsEvaluate differential effects on glycosylation versus apoptosis

These approaches require careful experimental design with appropriate controls to distinguish direct versus indirect effects, as glycosylation defects themselves can trigger cellular stress pathways leading to apoptosis .

How does DAD1 contribute to the structural integrity of the OST complex, and what are the implications for N-glycosylation efficiency?

DAD1's contribution to OST complex integrity extends beyond its catalytic role. Structural analyses indicate that DAD1 serves as an essential organizational component that maintains proper spatial arrangement of other OST subunits . When DAD1 is absent or dysfunctional, the entire OST complex becomes unstable, leading to compromised N-glycosylation efficiency across the proteome. Specific crosslinking studies have revealed that DAD1 directly interacts with OST48 and forms part of higher-order structures including DAD1-ribophorin II-OST48 heterotrimers and DAD1-ribophorin I-ribophorin II-OST48 heterotetramers .

The relative stoichiometry among these four polypeptides remains consistent throughout purification procedures, highlighting the non-labile nature of DAD1's interactions within the complex . This stability suggests that DAD1 plays a foundational role in OST assembly. From a functional perspective, all subunits of the OST complex, including DAD1, are required for maximal enzymatic activity, with studies demonstrating that both SST3A- and SS3B-containing OST complexes depend on DAD1 for proper assembly . These structural contributions directly impact N-glycosylation efficiency, as the spatial organization of the complex is critical for optimal substrate recognition and glycan transfer.

What are the current hypotheses explaining the connection between DAD1-mediated glycosylation defects and apoptotic pathways?

Several mechanistic hypotheses link DAD1 deficiency to apoptosis activation:

  • ER Stress Response: Impaired N-glycosylation due to DAD1 dysfunction leads to accumulation of misfolded proteins in the endoplasmic reticulum, triggering the unfolded protein response (UPR). Prolonged UPR activation can induce apoptosis through CHOP (C/EBP homologous protein) and JNK (c-Jun N-terminal kinase) signaling pathways.

  • Altered Glycoprotein Function: Critical receptors and signaling molecules depend on proper N-glycosylation for function. DAD1 deficiency may compromise survival signaling by affecting the folding, stability, or activity of key glycoproteins involved in cell fate decisions.

  • Direct Apoptotic Regulation: Some evidence suggests DAD1 may have glycosylation-independent functions in regulating apoptosis, potentially through protein-protein interactions with apoptotic machinery components.

  • Developmental Threshold Model: During embryonic development, even subtle glycosylation defects due to DAD1 dysfunction may cross critical thresholds that trigger developmental apoptosis programs, explaining why mice lacking DAD1 exhibit increased apoptotic-associated embryonic death .

Research examining temperature-sensitive DAD1 mutants in the tsBN7 cell line has been particularly informative, as the rapid induction of apoptosis following DAD1 protein disappearance at non-permissive temperatures suggests a direct link between DAD1 loss and cell death pathways .

How might the identification of DAD1 interaction partners contribute to understanding its function in different cellular contexts?

The identification of DAD1 interaction partners beyond the known OST complex components could reveal novel functional roles in different cellular contexts. Potential approaches include:

  • Proximity Labeling Techniques: BioID or APEX2 fusion proteins can identify proteins in close proximity to DAD1 in living cells, potentially revealing transient or context-specific interactions.

  • Co-immunoprecipitation Coupled with Mass Spectrometry: This approach can identify stable interaction partners under different cellular conditions (e.g., normal growth, ER stress, apoptotic stimuli).

  • Yeast Two-Hybrid Screening: Despite limitations with membrane proteins, modified Y2H systems could reveal direct binding partners for soluble domains of DAD1.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by MS analysis can capture both stable and transient interactions in native cellular environments.

These approaches would be particularly valuable for investigating whether DAD1 interacts with:

  • Components of the apoptotic machinery

  • ER stress response regulators

  • Protein quality control systems

  • Tissue-specific factors that may explain differential requirements for DAD1 in various cell types

Understanding DAD1's interaction network could help explain its role in carcinogenesis, as overexpression of DAD1 mRNA has been observed in some human hepatocellular carcinomas .

What are the most common technical challenges when working with recombinant DAD1, and how can researchers overcome them?

Researchers working with recombinant DAD1 frequently encounter several technical challenges:

  • Poor Expression Yields: As a membrane protein, DAD1 often expresses poorly in conventional systems. Solution: Optimize expression by using specialized strains/cell lines designed for membrane protein expression, lower induction temperatures, and fusion tags that enhance solubility.

  • Protein Aggregation: DAD1's hydrophobic nature promotes aggregation during purification. Solution: Include appropriate detergents throughout purification processes, consider purifying as part of the intact OST complex, and use glycerol in buffers to stabilize the native conformation.

  • Difficult Detection: DAD1 exhibits poor staining properties with Coomassie blue . Solution: Rely on alternative detection methods including silver staining, immunoblotting with specific antibodies, or epitope tagging of recombinant constructs.

  • Loss of Functionality: Isolated DAD1 may lose its native function when separated from the OST complex. Solution: When studying DAD1 function, consider co-expressing with other OST components or using membrane preparations rather than fully purified protein.

  • Antibody Cross-Reactivity: Antibodies against DAD1 may cross-react with other small proteins. Solution: Perform careful validation using recombinant DAD1 control fragments in blocking experiments, as well as knockout/knockdown controls .

For blocking experiments specifically, researchers should pre-incubate antibodies with 100x molar excess of appropriate control fragments for 30 minutes at room temperature to ensure specific binding .

How can researchers differentiate between direct effects of DAD1 manipulation and secondary consequences of disrupted N-glycosylation?

Distinguishing direct DAD1 effects from secondary glycosylation disruption requires careful experimental design:

  • Temporal Analysis: Monitor the time course of cellular responses after DAD1 disruption, as direct effects typically occur more rapidly than secondary consequences of impaired glycosylation.

  • Rescue Experiments With Functional Domains: Create constructs expressing specific DAD1 domains to determine which regions are necessary and sufficient for particular cellular responses.

  • Comparative Analysis With Other OST Subunits: Compare phenotypes resulting from DAD1 disruption with those caused by manipulating other OST components. Shared phenotypes likely result from general glycosylation defects, while unique outcomes may indicate DAD1-specific functions.

  • Glycosylation-Independent Mutants: Develop DAD1 mutants that maintain one function while losing another (e.g., apoptosis regulation without glycosylation function) through structure-guided mutagenesis.

  • Glycosylation Monitoring: Simultaneously track N-glycosylation status of marker proteins while assessing cellular phenotypes to establish correlation or dissociation between glycosylation defects and other outcomes.

This differential analysis is crucial because the demonstration that DAD1 is a core subunit of the OST suggests that induction of a cell death pathway upon loss of DAD1 in the tsBN7 cell line may primarily reflect the essential nature of N-linked glycosylation in eukaryotes, rather than a separate apoptosis-specific function .

What are the promising approaches for investigating DAD1's potential role in carcinogenesis and other pathological conditions?

Given the observation that DAD1 mRNA is overexpressed in some human hepatocellular carcinomas , several promising research approaches could further elucidate its role in cancer and other diseases:

  • Multi-Omics Profiling: Integrate transcriptomics, proteomics, and glycoproteomics analyses of cancer tissues with differential DAD1 expression to identify correlations with specific glycosylation patterns and altered cellular pathways.

  • CRISPR-Based Screening: Perform CRISPR-Cas9 screens in cancer cell lines to identify synthetic lethal interactions with DAD1, potentially revealing cancer-specific dependencies.

  • Patient-Derived Xenograft Models: Evaluate the effects of DAD1 modulation in PDX models to determine its impact on tumor growth, metastasis, and therapy response in physiologically relevant contexts.

  • Glycosylation-Focused Drug Development: Target DAD1 or its interaction partners as a novel approach to modulate N-glycosylation in a therapeutic context, potentially disrupting cancer-specific glycosylation patterns that support malignant phenotypes.

  • Immune Recognition Studies: Investigate how DAD1-dependent glycosylation affects immune recognition of cancer cells, as altered glycosylation can impact immune checkpoint molecules and antigen presentation.

These approaches would benefit from tissue-specific conditional knockout models to circumvent the embryonic lethality associated with complete DAD1 deletion, allowing researchers to study its function in adult tissues and in specific disease contexts .

How might emerging structural biology techniques advance our understanding of DAD1's integration within the OST complex?

Recent advances in structural biology offer unprecedented opportunities to characterize DAD1's precise role within the OST complex:

  • Cryo-Electron Microscopy: High-resolution cryo-EM studies of the intact OST complex would reveal DAD1's structural contributions and clarify how it interacts with other subunits, potentially identifying critical interaction interfaces.

  • Integrative Structural Biology: Combining multiple techniques (X-ray crystallography, NMR, crosslinking-MS, and computational modeling) could provide complementary structural insights, particularly regarding flexible regions not well-resolved by any single method.

  • Single-Particle Analysis: This approach could capture different conformational states of the OST complex during the catalytic cycle, revealing dynamic changes in DAD1's interactions throughout the glycosylation process.

  • In-Cell Structural Studies: Emerging methods for determining protein structures within cells would preserve native interactions and cellular context, potentially revealing associations that may be lost during purification.

  • Time-Resolved Structural Analysis: Techniques that capture structural changes over time could elucidate the sequence of events during OST complex assembly and identify the precise stage at which DAD1 incorporation occurs.

These structural insights would complement biochemical data showing that DAD1 forms crosslinked complexes with OST48, ribophorin II, and ribophorin I , providing atomic-level understanding of these interactions and potentially revealing novel therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.