Recombinant Rat Dynamin-like 120 kDa protein, mitochondrial (Opa1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Dynamin-like 120 kDa protein, mitochondrial (OPA1)

Recombinant Rat Dynamin-like 120 kDa protein, mitochondrial (OPA1) is a laboratory-produced version of the naturally occurring OPA1 protein found in rats (Rattus norvegicus). This recombinant protein, commercially available as product number RPE291Ra01, is produced through prokaryotic expression in Escherichia coli systems . It encompasses a specific fragment of the native rat OPA1 protein, spanning from amino acid residues Gln285 to Glu561, and includes His and TRxA tags to facilitate purification and detection in experimental settings .

The native OPA1 protein functions as a dynamin-related GTPase that regulates mitochondrial fusion and cristae structure in the inner mitochondrial membrane (IMM). This multifunctional protein contributes significantly to ATP synthesis and apoptosis regulation, making it a crucial component for cellular energy metabolism and programmed cell death pathways . In its natural context, OPA1 exists in multiple isoforms resulting from alternative splicing and proteolytic processing, with eight transcript variants reported in humans .

The significance of OPA1 extends beyond normal cellular physiology into pathological conditions. In humans, mutations in the OPA1 gene have been implicated in dominant optic atrophy (DOA), a condition characterized by progressive loss of visual acuity due to optic nerve degeneration . The recombinant rat version of this protein serves as an invaluable tool for researchers investigating mitochondrial dynamics, energy metabolism, and disease models related to mitochondrial dysfunction.

Function and Mechanism of Action

Recombinant Rat OPA1 retains the core functional domains of the native protein, making it suitable for investigating the molecular mechanisms underlying OPA1's biological activities. In its native cellular context, OPA1 serves as a multifunctional GTPase involved in several critical mitochondrial processes.

OPA1 also plays a crucial role in maintaining cristae structure within mitochondria. The cristae are folds of the inner mitochondrial membrane that house the respiratory chain complexes. OPA1 mediates cristae remodeling by oligomerizing at cristae junctions, with this oligomerization typically involving two L-OPA1 molecules and one S-OPA1 molecule . This structural arrangement is essential for maintaining optimal cristae architecture and, consequently, efficient oxidative phosphorylation.

Additionally, OPA1 contributes to the regulation of apoptosis by controlling the release of cytochrome c from mitochondria. By maintaining tight cristae junctions, OPA1 oligomers limit the mobilization of cytochrome c from the cristae spaces to the intermembrane space, thereby preventing its release into the cytosol and the subsequent activation of caspases that execute apoptosis . This function highlights the protein's role in cell survival and programmed cell death decisions.

OPA1 also responds to cellular stress conditions. Under low-energy substrate availability, mitochondrial SLC25A transporters can detect these conditions and stimulate OPA1 oligomerization . This leads to tightening of the cristae, enhanced assembly of ATP synthase, and increased ATP production, representing an adaptive response to energy stress . Conversely, stress conditions that compromise mitochondrial membrane potential can activate the protease OMA1, leading to increased processing of L-OPA1 to S-OPA1, which limits fusion and can promote mitochondrial fragmentation .

Recent research has also identified OPA1 as a regulator of T-helper Th17 cells, where it mediates mitochondrial membrane remodeling required for interleukin-17 (IL-17) production . This finding expands the known functions of OPA1 beyond mitochondrial dynamics into immune system regulation.

Production and Purification Methods

The specific fragment of OPA1 expressed (Gln285~Glu561) represents a portion of the protein that contains critical functional domains while excluding regions that might compromise expression or stability in a bacterial system . The inclusion of His and TRxA tags serves multiple purposes in the production and purification process. The histidine (His) tag facilitates purification through immobilized metal affinity chromatography (IMAC), allowing the recombinant protein to be selectively bound to metal resins and subsequently eluted with imidazole or a similar competitor. The thioredoxin (TRxA) tag often enhances protein solubility and stability in bacterial expression systems, potentially increasing yield and quality.

The purification process typically involves several steps beyond initial IMAC separation, which may include ion exchange chromatography, size exclusion chromatography, or other techniques to achieve the high purity (>95%) reported for the commercial product . Following purification, the protein is formulated in a stabilizing buffer and lyophilized to produce the freeze-dried powder form in which it is commercially available.

Applications in Research

Recombinant Rat OPA1 serves as a versatile tool in various experimental approaches, enabling researchers to investigate mitochondrial biology and related disease mechanisms. Its commercial availability facilitates consistent and reproducible research across different laboratories.

In immunological applications, the recombinant protein can function as an immunogen for antibody production, allowing the development of specific antibodies against rat OPA1 for immunodetection techniques . These antibodies can then be used in studies examining OPA1 expression, localization, and modifications in different tissues or under various experimental conditions.

The protein also serves as a positive control in analytical techniques such as sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and Western blotting (WB) . This application is particularly valuable for validating experimental procedures and ensuring the reliability of results when studying endogenous OPA1 in rat samples.

Beyond these specific applications, Recombinant Rat OPA1 can be employed in various research contexts, including:

  1. Structural Studies: Investigating the conformational states and structural dynamics of OPA1 using techniques such as X-ray crystallography or cryo-electron microscopy.

  2. Protein-Protein Interaction Studies: Identifying and characterizing interactions between OPA1 and other proteins involved in mitochondrial dynamics or related cellular processes.

  3. Enzymatic Assays: Measuring the GTPase activity of OPA1 and evaluating how it is affected by various experimental conditions or potential inhibitors/activators.

  4. Disease Modeling: Exploring how OPA1 function is altered in models of diseases associated with mitochondrial dysfunction, such as optic atrophy, neurodegeneration, or metabolic disorders .

  5. Drug Discovery: Screening for compounds that might modulate OPA1 function or processing as potential therapeutic agents for diseases involving mitochondrial dynamics dysregulation .

ApplicationDescription
ImmunogenFor antibody production against rat OPA1
Positive ControlFor SDS-PAGE and Western blot validation
Structural StudiesAnalysis of protein conformation and dynamics
Protein-Protein Interaction StudiesIdentification of binding partners and interaction mechanisms
Enzymatic AssaysMeasurement of GTPase activity under various conditions
Disease ModelingInvestigation of OPA1 dysfunction in disease contexts
Drug DiscoveryScreening for modulators of OPA1 function or processing

Role in Mitochondrial Dynamics

Mitochondria constantly undergo fusion and fission events in response to cellular needs and environmental conditions. OPA1 plays a central role in this dynamic equilibrium, specifically in mediating the fusion of inner mitochondrial membranes . The interplay between long forms of OPA1 (L-OPA1) and short forms (S-OPA1) is crucial for this regulation.

L-OPA1, which remains anchored to the inner mitochondrial membrane through its transmembrane domain, is required for mitochondrial fusion . In cooperation with mitofusins (MFN1 and MFN2), which mediate outer membrane fusion, L-OPA1 facilitates the merging of inner membranes, allowing content mixing between mitochondria . This fusion process is essential for maintaining mitochondrial DNA integrity, distributing metabolites and proteins throughout the mitochondrial network, and compensating for functional defects in individual mitochondria.

In contrast, S-OPA1, which results from proteolytic processing of L-OPA1 by the peptidases YME1L and OMA1, lacks the transmembrane domain and localizes to the intermembrane space . While S-OPA1 alone is insufficient for fusion, it can limit fusion efficiency and, under certain conditions, may facilitate mitochondrial fission . Studies have shown that overexpression of S-OPA1 leads to mitochondrial fragmentation, while expression of L-OPA1 that lacks cleavage sites promotes mitochondrial fusion and can even induce hyperfusion under specific stress conditions .

The proteolytic processing of OPA1 is tightly regulated and responds to various cellular signals. YME1L-mediated processing occurs under basal conditions and may be linked to the quality control of OPA1 and the fine-tuning of mitochondrial dynamics . In contrast, OMA1-mediated processing is activated under stress conditions, such as mitochondrial membrane potential loss or ATP depletion . This stress-induced processing leads to increased conversion of L-OPA1 to S-OPA1, limiting fusion and potentially promoting fission, which may represent an adaptive response to segregate damaged mitochondria for subsequent removal by mitophagy.

OPA1 FormLocationRole in Mitochondrial Dynamics
L-OPA1Inner mitochondrial membrane (membrane-bound)Promotes mitochondrial fusion; required for maintaining tubular mitochondrial network
S-OPA1Intermembrane space (soluble)Limits fusion; may facilitate fission; colocalizes with outer membrane fission machinery
Oligomeric OPA1 (L+S)Cristae junctionsMaintains cristae structure; regulates respiratory efficiency; prevents cytochrome c release

Relevance to Disease Models

Recombinant Rat OPA1 serves as a valuable tool for investigating disease models related to mitochondrial dysfunction, particularly those involving alterations in mitochondrial dynamics or OPA1 function. Research in this area has significant implications for understanding and potentially treating various human diseases.

Mutations in the human OPA1 gene are the primary cause of autosomal dominant optic atrophy (ADOA), a condition characterized by the degeneration of retinal ganglion cells and the optic nerve, resulting in progressive vision loss . While ADOA primarily affects vision, patients with OPA1 mutations may also experience a range of additional symptoms, including deafness, ataxia, sensorimotor neuropathy, progressive external ophthalmoplegia, and mitochondrial myopathy, reflecting the widespread importance of OPA1 function throughout the body .

These OPA1-related diseases can be modeled using rat systems, where the recombinant protein plays a crucial role in mechanistic studies. In such models, heterozygous Opa1 mutations replicate many features of human ADOA and may also lead to additional phenotypes such as cardiomyopathy . These models exhibit abnormal mitochondrial morphology and dysfunction, including defects in oxidative phosphorylation and mitochondrial DNA instability.

Beyond its direct role in genetic diseases, dysregulation of OPA1 processing and function has been implicated in various other pathological conditions. Excessive processing of OPA1 by the stress-activated protease OMA1, leading to mitochondrial fragmentation, has been observed in models of neurodegenerative diseases, ischemia-reperfusion injury, and metabolic disorders . This suggests that maintaining proper OPA1 function and mitochondrial dynamics may be broadly relevant to human health and disease.

Recent research has also suggested a potential association between mitochondrial fusion involving OPA1 and MFN2 and Parkinson's disease . This finding expands the relevance of OPA1 research to a broader range of neurodegenerative conditions and highlights the importance of maintaining proper mitochondrial dynamics for neuronal health.

In the therapeutic realm, Stoke Therapeutics is evaluating the splice-switching antisense oligonucleotide STK-002 as a potential treatment for DOA . This approach aims to reduce poison exon inclusion in the OPA1 transcript, leading to increased functional OPA1 protein levels. Such therapeutic strategies highlight the potential clinical applications of OPA1 research using recombinant proteins for functional studies.

Comparative Analysis with OPA1 from Other Species

Recombinant Rat OPA1 provides an opportunity to compare the structure, function, and regulation of this protein across different species. Such comparative analyses can reveal evolutionarily conserved features that are likely to be functionally critical, as well as species-specific adaptations that might reflect different physiological demands or regulatory mechanisms.

The OPA1 protein is highly conserved across mammalian species, reflecting its essential role in mitochondrial function. Human OPA1, rat OPA1, and OPA1 from other mammals such as Sumatran orangutan share significant sequence homology and functional similarities . All maintain the core GTPase domain characteristic of dynamin-related proteins and possess similar mechanisms of action in regulating mitochondrial fusion and cristae morphology.

In Sumatran orangutan, as in humans and rats, OPA1 exists in both long (L-OPA1) and short (S-OPA1) forms, with the long form tethered to the inner mitochondrial membrane and the short form resulting from proteolytic cleavage and localizing to the intermembrane space . The balance between these forms is crucial for proper mitochondrial function across species, with excess levels of S-OPA1 leading to impaired mitochondrial fusion .

The proteolytic processing of OPA1 by peptidases such as YME1L and OMA1 appears to be conserved across mammals, suggesting that this regulatory mechanism is fundamental to OPA1 function . Similarly, the role of OPA1 in cristae remodeling and cytochrome c release during apoptosis is observed across species, highlighting the evolutionary importance of this function .

Despite these similarities, there may be subtle differences in OPA1 regulation and processing between species. For instance, the specific patterns of alternative splicing, which generates different OPA1 isoforms, may show species-specific variations. These differences could affect how OPA1 responds to various cellular signals and stresses in different experimental models.

Understanding these cross-species similarities and differences is important when using rat OPA1 as a model for studying human diseases or when translating findings from rat studies to human applications. Recombinant proteins from different species enable direct comparative studies that can illuminate these aspects.

FeatureRat OPA1Human OPA1Orangutan OPA1
Core FunctionRegulates mitochondrial fusion and cristae structureRegulates mitochondrial fusion and cristae structureRegulates mitochondrial fusion and cristae structure
Proteolytic ProcessingProcessed by YME1L and OMA1 to generate L and S formsProcessed by YME1L and OMA1 to generate L and S formsProcessed by YME1L and OMA1 (by similarity)
Role in DiseaseModel for human conditions in experimental settingsMutations cause ADOA and related disordersLikely similar to human (specific pathologies less studied)
Experimental UtilityCommonly used in laboratory research due to rat model systemsPrimary relevance to human diseaseComparative evolutionary studies

Future Research Directions

Research utilizing Recombinant Rat OPA1 continues to expand our understanding of mitochondrial dynamics and related diseases. Several promising directions for future investigation have emerged, offering potential for both basic scientific advances and therapeutic applications.

One significant area of ongoing research focuses on preventing pathological OPA1 processing. Since excessive processing of L-OPA1 to S-OPA1 by the stress-activated protease OMA1 can lead to mitochondrial fragmentation and contribute to cell death in various disease contexts, interventions that modulate this process represent an exciting therapeutic avenue . Specific inhibitors of OMA1 or compounds that stabilize L-OPA1 against proteolytic processing could potentially preserve mitochondrial integrity in conditions ranging from neurodegenerative diseases to ischemia-reperfusion injury.

Another promising approach involves antisense oligonucleotide therapy. For instance, Stoke Therapeutics is evaluating a splice-switching antisense oligonucleotide (STK-002) as a potential treatment for dominant optic atrophy . This approach aims to reduce the inclusion of a "poison exon" in the OPA1 transcript, thereby increasing functional OPA1 protein levels. While this specific therapy targets human OPA1, similar approaches could be developed for experimental models using rat OPA1, potentially offering insights into the efficacy and mechanisms of such interventions.

Further research is also needed to elucidate the precise mechanisms by which OPA1 mediates inner membrane fusion and maintains cristae structure. Structural studies of OPA1, including its different forms and oligomeric states, could provide crucial insights into these processes. Recombinant OPA1 offers a valuable tool for such structural investigations, potentially revealing targets for specific molecular interventions.

The interaction between OPA1 and other proteins involved in mitochondrial dynamics, such as mitofusins, DRP1, and various proteases, represents another important area for investigation. Mapping these interaction networks and understanding how they respond to different cellular conditions could reveal new regulatory mechanisms and potential therapeutic targets.

Finally, the role of OPA1 in specific cellular contexts and disease states requires further exploration. For instance, the function of OPA1 in immune cells, where research has identified a role in T-helper Th17 cell regulation and interleukin-17 production , may have implications for autoimmune diseases and inflammation. Similarly, the involvement of OPA1 in metabolic regulation and adaptation to energy stress suggests potential relevance to metabolic disorders and aging-related decline.

Research DirectionPotential ApproachAnticipated Impact
Preventing pathological OPA1 processingDevelopment of OMA1 inhibitors or L-OPA1 stabilizersTherapeutic interventions for diseases involving mitochondrial fragmentation
Antisense oligonucleotide therapyModulation of OPA1 splicing to increase functional protein levelsTreatment for OPA1-related genetic diseases
Structural studies of OPA1X-ray crystallography, cryo-EM of recombinant OPA1Mechanistic insights into fusion and cristae maintenance
OPA1 interactome analysisProteomics, co-immunoprecipitation, proximity labelingIdentification of new regulatory mechanisms and therapeutic targets
Tissue-specific OPA1 functionsConditional knockout models, tissue-specific expressionUnderstanding of OPA1 roles in different physiological contexts

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Opa1; Dynamin-like 120 kDa protein, mitochondrial; Optic atrophy protein 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
195-960
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Opa1
Target Protein Sequence
ATDHGSESDKHYRKVSDKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKG IHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIF PRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEG CTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIIL CIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMK ALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWK MVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPK HWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAW ETLQDEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRS ISDKQQWDAAIYFMEEALQGRLKDTENAIENMIGPDWKKRWIYWKNRTQEQCVHNETKNE LEKMLKVNDEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCN LCRRGFYYYQRHFIDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVL EDFAEDGEKKVKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
Uniprot No.

Target Background

Function
Dynamin-related GTPase crucial for maintaining normal mitochondrial morphology by regulating the balance between mitochondrial fusion and fission. Co-expression of isoform 1 with shorter alternative products is essential for optimal activity in promoting mitochondrial fusion. It binds lipid membranes enriched in negatively charged phospholipids, such as cardiolipin, and induces membrane tubulation. Its intrinsic GTPase activity is low but significantly increases upon interaction with lipid membranes. It plays a role in cristae remodeling and cytochrome c release during apoptosis. Proteolytic processing in response to intrinsic apoptotic signals can lead to the disassembly of OPA1 oligomers and the release of the caspase activator cytochrome C (CYCS) into the mitochondrial intermembrane space. It also contributes to mitochondrial genome maintenance. An inactive form is produced by cleavage at position S1 by OMA1 following stress conditions that induce loss of mitochondrial membrane potential, resulting in negative regulation of mitochondrial fusion. Isoforms containing the alternative exon 4b (present in isoform 2 and 3, but not in isoform 1) are required for mitochondrial genome maintenance, potentially by anchoring mitochondrial nucleoids to the inner mitochondrial membrane.
Gene References Into Functions
  1. Evidence suggests that ROS-dependent apoptosis is associated with an alteration of mitochondrial cAMP/PKA signaling, leading to degradation/proteolysis of Sirt3. This, in turn, promotes acetylation and proteolytic processing of OPA1 PMID: 27890624
  2. Retinal ischemia-reperfusion (I/R) or hypoxia-reoxygenation (H/R) injury induces a loss of Opa1 long isoforms. PMID: 26530815
  3. Data indicate a significant increase in the expression of the dynamin-related GTPase OPA1 in pretreated groups, particularly in the pre-exercised ischemia group compared to non-treated groups. PMID: 24633199
  4. Chronic muscle use elevates the ratio of opa1, leading to reticular mitochondria, while muscle disuse and aging decrease this ratio, resulting in fragmented mitochondria. PMID: 23494933
  5. Data suggest that OPA1 cleavage is a likely convergence point for mitochondrial dysfunction and imbalances in mitochondrial fission and fusion induced by oxidative or nitrosative stress. PMID: 23220553
  6. OPA1 plays a role in synaptic maturation and dendritic growth through mitochondrial dynamics in neuronal functioning. PMID: 23543485
  7. These findings suggest that mitochondrial preservation after inhibition of NOS-2 may be beneficial for protecting retinal ganglion cells from glaucomatous damage. PMID: 21220562
  8. The data suggest a critical and specific function of the OPA1 protein not only in the optic nerve forming ganglion cells but also in the intrinsic signal processing of the inner retina. PMID: 15505078
  9. OPA1 is predominantly expressed in retinal ganglion cells of the normal rat retina and axons of the optic nerve. These findings may explain the selective vulnerability of retinal ganglion cells to OPA1 loss of function. PMID: 15912498
  10. Mammalian mitochondrial function and morphology are regulated through OPA1 processing in a DeltaPsi-dependent manner. PMID: 16778770
  11. Expression analyses of OPA1 were conducted in the rat auditory and vestibular organ. PMID: 17828551
  12. Data provide the first demonstration of OPA1 cleavage during neuronal apoptosis, implicating caspases as indirect regulators of OPA1 processing in degenerating neurons. PMID: 19046944
  13. These results indicate that OPA1 release from mitochondria triggered by acute intraocular pressure elevation is inhibited by blocking glutamate receptor activation. PMID: 19122832
  14. Apoptotic cell death via reduction of OPA1 and mitochondrial fusion may contribute to heart failure progression. PMID: 19493956

Show More

Hide All

Database Links

KEGG: rno:171116

UniGene: Rn.225901

Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion intermembrane space. Mitochondrion membrane.
Tissue Specificity
Expressed in brain as well as retinal ganglion, starbust amacrine and horizontal cells of the retina. Absent from nerve fibers and photoreceptor cells of the retina.

Q&A

What is OPA1 and what are its primary cellular functions?

OPA1 is a dynamin-related GTPase required for mitochondrial fusion and regulation of apoptosis. It exists both as a single-pass membrane protein in the inner mitochondrial membrane and as soluble forms in the mitochondrial intermembrane space. The protein is primarily expressed in retina, brain, testis, heart, and skeletal muscles .

Key functions include:

  • Mediating inner mitochondrial membrane fusion

  • Regulating cristae structure formation and maintenance

  • Preventing cytochrome C release during apoptosis

  • Contributing to respiratory efficiency and supercomplex formation

Defects in OPA1 function lead to autosomal dominant optic atrophy (ADOA), a leading cause of inherited blindness .

What are the key structural domains of OPA1 and how do they influence function?

OPA1 contains several critical functional domains:

  • GTPase domain: Essential for GTP hydrolysis that powers membrane fusion events

  • GTPase effector domain (GED): Regulates GTPase activity and participates in protein oligomerization

  • Middle domain: Facilitates protein-protein interactions

  • Transmembrane domain: Anchors membrane-bound forms to the inner mitochondrial membrane

Research demonstrates that mutations in these domains produce distinctive functional consequences. Studies using OPA1 mutants with either GTPase (c.899G>A, c.1334G>A) or GED (c.2708delTTAG) defects revealed that GTPase domain mutations severely impair both fusion and fission processes and are linked to more severe multisystemic forms of ADOA. In contrast, GED mutants retain partial fusion activity and partial GTPase function, typically resulting in milder phenotypes .

How does OPA1 processing occur in mitochondria?

OPA1 undergoes complex post-translational processing within mitochondria:

  • Initial import via mitochondrial targeting sequence

  • Proteolytic processing by proteases including PARL (Presenilin Associated Rhomboid Like)

  • Generation of both long (membrane-anchored) and short (soluble) isoforms

The balance between these isoforms is critical for proper mitochondrial function. Human OPA1 isoform 1 is the most abundant variant in human and mouse tissues, though multiple splice variants exist . Proteolytic processing occurs in response to various stimuli, including changes in membrane potential or apoptotic signals, leading to disassembly of OPA1 oligomers and potential release of cytochrome C .

How do domain-specific OPA1 mutations correlate with disease phenotypes?

Studies have revealed distinct correlations between mutation location and disease severity:

DomainExample MutationsFunctional ImpactDisease Phenotype
GTPasec.899G>A, c.1334G>ASevere impairment of fusion/fissionMore severe multisystemic ADOA+
GEDc.2708delTTAGPartial retention of fusion activityClassic optic atrophy, often milder

Patients with GTPase domain mutations frequently develop "OPA1+" syndrome with extraocular manifestations including ataxia, myopathy, peripheral neuropathy, and progressive external ophthalmoplegia beginning in the third decade of life . While missense mutations show an increased association with these expanded phenotypes (odds ratio = 3.06), multi-system neurological complications can occur with all mutational subtypes .

Epidemiological data indicates that extraocular neurological complications affect approximately 20% of all OPA1 mutation carriers, with sensorineural deafness being a particularly common manifestation .

What mechanisms underlie OPA1's role in oxidative metabolism?

OPA1 deficiency significantly impairs oxidative metabolism through multiple mechanisms:

Research using RNA silencing strategies in human epithelial cell lines demonstrated that these effects occur not only in neurons but also in cycling cells, supporting OPA1's universal importance for cellular metabolism . This suggests potential translational applications for using dividing cells to model OPA1-related bioenergetic defects in post-mitotic tissues like neurons.

How do different OPA1 isoforms contribute to mitochondrial dynamics and pathology?

Human OPA1 exists in multiple isoforms through alternative splicing and proteolytic processing. Therapeutic research has focused particularly on isoforms 1 and 7:

  • Isoform 1: Most abundant variant in human and mouse tissues, extensively studied in rescue experiments

  • Isoform 7: Also shows therapeutic potential in disease models

Studies using codon-optimized versions of OPA1 isoforms 1 and 7 have demonstrated their therapeutic benefit in models of ADOA. AAV-delivered OPA1 isoform 1 showed significant protection of retinal ganglion cells (RGCs) in a mouse model heterozygous for pathogenic OPA1 mutation (Opa1 delTTAG/+), though it did not significantly improve visual acuity .

Beyond ADOA, therapeutic applications extend to other conditions including:

  • Protection from reperfusion ischemia damage

  • Mitigation of neuronal cell loss in acute ischemic stroke

  • Benefits in chemical models of ocular mitochondrial uncoupling

  • Protection in laser-induced models of glaucoma

What is the relationship between OPA1, embryonic development, and tissue-specific pathology?

OPA1 is essential for embryonic development, as demonstrated by several key findings:

  • OPA1 knockout mice lose viability around embryonic day 9, indicating an absolute requirement for development

  • In zebrafish models, OPA1 depletion causes:

    • Disrupted mitochondrial morphology

    • Abnormal blood circulation and heart defects

    • Small eyes and underdeveloped pectoral fin buds

    • Reduced startle response and impaired locomotor activity

This progressive involvement of diverse tissues may reflect a threshold effect, where tissues with the highest energy demands show earliest pathology, followed by those with intermediate requirements when dysfunction reaches a critical level.

What are recommended approaches for handling recombinant rat OPA1 protein in laboratory settings?

When working with recombinant rat OPA1 protein:

Storage and Stability:

  • Store at 2-8°C for one month or aliquot and store at -80°C for 12 months

  • Avoid repeated freeze/thaw cycles

  • Thermal stability tests show less than 5% degradation when incubated at 37°C for 48h under appropriate storage conditions

Reconstitution and Handling:

  • Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL

  • Avoid vortexing to prevent protein denaturation

  • When sourced from prokaryotic expression systems (e.g., E. coli), the protein typically includes a His tag and TRxA tag

Quality Considerations:

  • Verify endotoxin levels (<1.0EU per 1μg is standard for research applications)

  • Confirm protein purity (>95% is recommended for experimental use)

  • Validate molecular mass (predicted molecular mass for rat OPA1 fragments is approximately 51.1kDa, though actual mass on SDS-PAGE may be around 48kDa)

What experimental systems are optimal for studying OPA1 function and disease mutations?

Multiple experimental systems have proven valuable for OPA1 research:

Cell-Based Systems:

  • Acute rescue studies: Using OPA1-null (Opa1−/−) mouse embryonic fibroblasts (MEFs) transfected with wild-type or mutant OPA1 constructs allows direct comparison of mutation effects without confounding genetic backgrounds

  • RNA silencing approaches: Effective for studying oxidative metabolism changes in replicative cells

  • Patient-derived cells: Fibroblasts from individuals with OPA1 mutations provide insights into pathophysiology, though genetic backgrounds vary

Animal Models:

  • Transgenic mice: Both constitutive and conditional OPA1 expression/knockout models

  • Zebrafish models: Allow visualization of developmental effects and bioenergetic consequences through antisense morpholino approaches

Construct Design:
When designing experimental plasmids encoding human OPA1, researchers typically use isoform 1 as it is the most abundant in human and mouse tissues. Patient mutations can be introduced through site-directed mutagenesis (examples include c.899G>A and c.1334G>A for GTPase domain studies and c.2708delTTAG for GED domain investigations) .

What techniques are most effective for assessing mitochondrial dynamics in OPA1 research?

To comprehensively evaluate OPA1's impact on mitochondrial dynamics, researchers employ multiple complementary techniques:

Structural Analysis:

  • Transmission electron microscopy for ultrastructural analysis of cristae morphology

  • Confocal or super-resolution microscopy with mitochondrial markers to visualize network morphology

  • Time-lapse imaging to capture fusion/fission events

Functional Assessments:

  • Oxygen consumption rate (OCR) measurements in intact cells or isolated mitochondria

  • Mitochondrial membrane potential determination using potentiometric dyes

  • Evaluation of apoptotic sensitivity and cytochrome C release

Molecular Techniques:

  • Analysis of OPA1 processing patterns via Western blotting

  • Assessment of mitochondrial DNA stability and copy number

  • GTPase activity assays for wild-type and mutant OPA1 variants

Experimental Design Considerations:
When conducting oxygen consumption measurements in OPA1-depleted models (such as zebrafish morphants), measurements should be taken at multiple timepoints (e.g., 24, 48, and 72 hours post-fertilization) to capture temporal changes in mitochondrial function .

How can researchers distinguish between primary and secondary effects of OPA1 dysfunction?

Differentiating primary from secondary consequences of OPA1 dysfunction requires systematic experimental approaches:

Acute vs. Chronic Models:

  • Acute depletion/inhibition models reveal immediate effects of OPA1 loss

  • Chronic models (patient cells, stable knockdowns) show adaptive responses and disease progression

Temporal Analysis:

  • Time-course experiments capturing early through late changes

  • Tracking compensatory responses such as transient upregulation of PGC1α observed in OPA1-depleted zebrafish

Rescue Experiments:

  • Domain-specific mutant analysis to isolate function (GTPase vs. GED domain contributions)

  • Expression of alternate isoforms to identify critical functional elements

Compartment-Specific Analysis:

  • Separate assessment of membrane dynamics, cristae structure, and bioenergetics

  • Measurement of oxidative stress markers (like aconitase activity) alongside antioxidant responses (NRF2 translocation, SOD1/GSTP1 upregulation)

These approaches help distinguish OPA1's direct effects on membrane dynamics from secondary consequences on metabolism, redox balance, and apoptotic signaling.

What therapeutic approaches targeting OPA1 show promise for mitochondrial diseases?

Current research has identified several promising OPA1-targeted therapeutic strategies:

Gene Therapy Approaches:

  • AAV-delivered OPA1 (isoform 1) provides protection of retinal ganglion cells in mouse models heterozygous for pathogenic OPA1 mutations (Opa1 delTTAG/+)

  • Benefits extend beyond DOA to other conditions including glaucoma models and chemical-induced mitochondrial uncoupling

Isoform-Specific Interventions:

  • Codon-optimized versions of OPA1 isoforms 1 and 7 show therapeutic benefit in various models

  • l-form OPA1 can alleviate acute ischemic stroke injury in rat brain, preventing neuronal cell loss

Broader Applications:

  • Constitutive OPA1 expression increases mitochondrial supercomplex formation

  • OPA1 overexpression provides protection from reperfusion ischemia damage

  • OPA1 mitigates deleterious effects of other mitochondrial dysfunction models (Ndufs4−/− and Cox15)

These findings suggest OPA1-targeted therapies may have applications beyond classical ADOA to a wider range of mitochondrial and neurodegenerative conditions.

What experimental readouts best assess therapeutic efficacy in OPA1-related disease models?

Comprehensive evaluation of therapeutic interventions requires multiple outcome measures:

Cellular/Molecular Metrics:

  • Mitochondrial network morphology restoration

  • Cristae ultrastructure normalization

  • Respiratory chain complex activity and supercomplex formation

  • ROS production and antioxidant response normalization

  • Restoration of proper OPA1 processing patterns

Tissue/Functional Outcomes:

  • Retinal ganglion cell survival quantification

  • Visual acuity measurements (in visual system models)

  • Neuronal functionality assays for non-visual manifestations

  • Behavioral assessments in animal models (locomotor activity, startle response)

Experimental Design Considerations:

  • Include age-matched controls due to progressive nature of mitochondrial diseases

  • Assess long-term maintenance of therapeutic effect

  • Consider tissue-specific responses (visual system vs. other affected tissues in OPA1+ syndrome)

A critical observation from current research is that while AAV-delivered OPA1 significantly protected RGCs in mouse models, it did not always translate to significant improvements in visual acuity , highlighting the importance of assessing both cellular and functional outcomes.

What are the critical unanswered questions in OPA1 research?

Despite significant advances, several fundamental questions about OPA1 remain unresolved:

Mechanistic Questions:

  • How do different domains of OPA1 cooperate in membrane fusion and cristae maintenance?

  • What determines tissue-specific vulnerability to OPA1 dysfunction?

  • How do nuclear background and mitochondrial DNA haplotypes modify disease expression?

Clinical Questions:

  • What factors drive the development of OPA1+ syndrome in only a subset of mutation carriers?

  • Why do identical mutations produce variable phenotypes even within families?

  • What determines the age of onset and progression rate in OPA1-related diseases?

Therapeutic Questions:

  • Can isoform-specific interventions target particular aspects of OPA1 function?

  • What is the optimal therapeutic window for intervention in OPA1-related diseases?

  • Are there pharmacological approaches to enhance residual OPA1 function in patients with partial loss-of-function mutations?

Addressing these questions will require integrated approaches combining structural biology, advanced imaging, patient-derived models, and longitudinal clinical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.