Recombinant Rat E3 ubiquitin-protein ligase MARCH11 (March11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Marchf11; March11; E3 ubiquitin-protein ligase MARCHF11; Membrane-associated RING finger protein 11; Membrane-associated RING-CH protein XI; MARCH-XI; RING-type E3 ubiquitin transferase MARCHF11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
March11
Target Protein Sequence
MSDEGSKRGSRADSLEAEPPLPPPPPPPPPGESSLVPTSPRYRPPLPAPLERIVGSGEPP VELAPRRKGEPLPPLPPSRLPGDQEVSAAGDSCEGPRRLPEVKLPEAAAGKGSPAEPEAG ACREGERRGTGDQPETRSVYSSRSSSSGGSGDQRSGHQHQHHQPICKICFQGAEQGELLN PCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVTAIKMKQPCQWQSISITLVEKVQ MIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEGAA VYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLSALRNRNLVHPTQLTS PRFQCGYVLLHLFNRMRAHEDVSEDNGSGEVVMRVTSV
Uniprot No.

Target Background

Function

MARCH11 is an E3 ubiquitin-protein ligase that mediates the polyubiquitination of CD4. As an E3 ubiquitin ligase, it accepts ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester bond and directly transfers the ubiquitin to target substrates. It may play a role in ubiquitin-dependent protein sorting during spermatid development.

Gene References Into Functions
  1. MARCH11 functions as a ubiquitin ligase involved in ubiquitin-mediated protein sorting within the TGN-MVB transport pathway, potentially playing a role in mammalian spermiogenesis. PMID: 17604280
Database Links
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in testis. Present in early developing spermatids. Not present in spermatogonia, spermatocytes or somatic cells (i.e. peritubular, Leydig, and Sertoli cells). Present in early round spermatids at step 4, remains until step 11, then

Q&A

What is Recombinant Rat E3 ubiquitin-protein ligase MARCH11?

Recombinant Rat E3 ubiquitin-protein ligase MARCH11 (MARCH-XI) is a novel member of the membrane-associated RING-CH family of proteins that functions as a transmembrane ubiquitin ligase. It is predominantly expressed in developing spermatids with weaker expression detected in brain and pituitary tissues. MARCH11 possesses E3 ubiquitin ligase activity and has been shown to target CD4 for ubiquitination in experimental systems . As a recombinant protein, it is engineered to contain the functional domains of the native rat MARCH11 expressed in a heterologous system to facilitate experimental investigation of its biological properties and functions.

What cellular components does MARCH11 interact with?

MARCH11 forms complexes with multiple cellular components critical to protein trafficking and sorting. Immunoprecipitation studies in rat testes have demonstrated that MARCH11 interacts with:

  • Adaptor protein complex-1 (AP-1)

  • Fucose-containing glycoproteins, including their ubiquitinated forms

  • μ1-adaptin through a tyrosine-based motif in its C-terminal region

  • Veli protein via a PDZ binding motif

These interactions suggest MARCH11 functions as a crucial component in the trans-Golgi network (TGN) to multivesicular body (MVB) transport pathway, potentially coordinating cargo selection and ubiquitination during vesicular transport.

What is the subcellular localization pattern of MARCH11?

Immunoelectron microscopy studies of rat round spermatids have revealed a specific subcellular distribution pattern for MARCH11. The protein is primarily localized to:

  • TGN-derived vesicles

  • Multivesicular bodies (MVBs)

This localization pattern is consistent with its proposed function in ubiquitin-mediated protein sorting between these compartments. The concentrated presence in these structures suggests MARCH11 may play specialized roles in spermatid development by regulating protein trafficking through the TGN-MVB pathway.

What expression systems are most effective for producing functional recombinant MARCH11?

Based on established protocols for producing membrane-bound E3 ubiquitin ligases, the following expression systems can be employed for recombinant MARCH11 production with varying advantages:

Expression SystemAdvantagesLimitationsYield
E. coliCost-effective, rapid growthLimited post-translational modifications, potential improper folding of transmembrane domainsLow-medium
Insect cells (Sf9, High Five)Mammalian-like post-translational modificationsMore complex cultivation requirementsMedium-high
Mammalian cells (HEK293, CHO)Native-like post-translational modifications and foldingHigher cost, slower growthMedium

When producing recombinant MARCH11, it is critical to include appropriate affinity tags (such as His6 or FLAG) while ensuring they do not interfere with the RING-CH domain's E3 ligase activity. Similar to other recombinant proteins, purification optimization typically requires testing multiple expression conditions, detergents for membrane protein solubilization, and buffer compositions to maintain stability and activity .

What methodological approaches can assess MARCH11 E3 ligase activity in vitro?

Multiple complementary approaches can be employed to evaluate the E3 ligase activity of recombinant MARCH11:

  • In vitro ubiquitination assays: Combining purified recombinant MARCH11 with E1, E2, ubiquitin, ATP, and potential substrates (e.g., CD4) to detect the formation of ubiquitinated products via western blotting or mass spectrometry.

  • FRET-based ubiquitination sensors: Utilizing fluorescently labeled ubiquitin and substrates to monitor ubiquitination in real-time.

  • Surface plasmon resonance (SPR): Measuring binding kinetics between MARCH11, E2 enzymes, and potential substrates.

  • Auto-ubiquitination assays: Detecting MARCH11 self-ubiquitination as a proxy for enzymatic activity.

When designing these assays, it is essential to include appropriate controls such as catalytically inactive MARCH11 mutants (typically with mutations in the RING-CH domain) and to optimize reaction conditions (pH, salt concentration, temperature) to maintain membrane protein stability while allowing for enzymatic activity.

How does MARCH11 contribute to ubiquitin-dependent sorting in germ cells?

MARCH11 likely serves as a critical component in the specialized ubiquitin-dependent sorting machinery in developing spermatids. Unlike somatic cells where the ubiquitin-dependent sorting pathway is well characterized, this pathway remains less defined in germ cells . Based on current evidence, MARCH11 functions in this pathway through:

  • Recognition and binding of cargo proteins through its interaction with adaptor protein complex-1

  • Ubiquitination of selected cargo proteins via its E3 ligase activity

  • Facilitation of cargo sorting from the TGN to MVBs through interactions with the transport machinery

The C-terminal region of MARCH11 appears crucial for these functions as it mediates interactions with μ1-adaptin through a tyrosine-based motif and with Veli via a PDZ binding motif . These protein-protein interactions likely coordinate cargo selection with ubiquitination to ensure proper protein sorting during spermiogenesis.

What experimental designs are optimal for studying MARCH11 cargo selection?

Investigating MARCH11's cargo selection mechanisms requires sophisticated experimental approaches combining protein interaction studies with functional analyses:

  • Proximity labeling techniques: BioID or TurboID fused to MARCH11 can identify proteins in close proximity to MARCH11 in developing spermatids.

  • Quantitative proteomics: Comparing the ubiquitinome of wild-type versus MARCH11-deficient spermatids can identify physiological substrates.

  • Domain mapping experiments: Systematic analysis of MARCH11 domains through truncation and point mutations to determine regions responsible for cargo recognition versus ubiquitination.

  • Cargo trafficking assays: Fluorescently labeled potential cargo proteins can be tracked in the presence of wild-type versus mutant MARCH11 to assess sorting efficiency.

When designing these experiments, researchers should consider the specialized nature of spermatid development and the potential for cell-type specific interactions that may not be recapitulated in heterologous expression systems.

What are the challenges in differentiating MARCH11 function from other MARCH family members?

Distinguishing the specific functions of MARCH11 from other MARCH family proteins presents several experimental challenges:

ChallengeRecommended ApproachConsiderations
Structural similarityCrystal structure determination of MARCH11 RING-CH domainMembrane protein crystallization difficulties
Overlapping substrate specificitySubstrate profiling in MARCH11-specific knockout modelsPotential compensation by other MARCH proteins
Similar subcellular localizationSuper-resolution microscopy with specific antibodiesLimited availability of specific antibodies
Redundant cellular functionsCombined depletion of multiple MARCH proteinsPotential developmental abnormalities complicating analysis

To overcome these challenges, researchers should employ multiple complementary approaches and consider using tissue-specific and inducible gene modification systems to avoid developmental complications when studying MARCH11 function.

What is the proposed role of MARCH11 in mammalian spermiogenesis?

MARCH11's predominant expression in developing spermatids suggests a specialized function during spermiogenesis. Current evidence indicates MARCH11 may be involved in:

  • Remodeling of cellular components during spermatid differentiation through selective protein degradation

  • Formation of specialized structures through regulated protein trafficking

  • Elimination of unnecessary proteins during cytoplasmic reduction

The protein's localization to TGN-derived vesicles and MVBs positions it as a regulator of protein sorting during these dramatic cellular transformations . MARCH11 likely helps coordinate the extensive membrane reorganization and protein composition changes required for spermatid maturation.

How can researchers effectively study MARCH11 in the context of spermatogenesis?

Studying MARCH11 in spermatogenesis requires specialized techniques addressing the complexities of male germ cell development:

  • Stage-specific isolation: Techniques such as STA-PUT or FACS can separate spermatogenic cells at different developmental stages to examine stage-specific MARCH11 expression and function.

  • Ex vivo culture systems: Organotypic testicular cultures allow manipulation of MARCH11 expression/function while maintaining the appropriate cellular environment.

  • Conditional gene targeting: Spermatid-specific Cre drivers can be used to delete or modify MARCH11 specifically during spermiogenesis.

  • Intratesticular injection: Direct introduction of experimental constructs (siRNAs, expression vectors) into the testis can modify MARCH11 function in vivo.

When designing these experiments, researchers should consider the timing of MARCH11 expression during spermatogenesis and potential compensation by other ubiquitin ligases to accurately interpret results.

What techniques are most effective for identifying MARCH11 binding partners?

Multiple complementary approaches can be employed to comprehensively identify and validate MARCH11-interacting proteins:

TechniqueAdvantagesLimitationsApplication
Co-immunoprecipitationDetects native interactionsLimited to stable interactionsConfirmation of specific interactions
Yeast two-hybridHigh-throughput screeningPotential false positivesInitial identification of binding partners
Proximity labeling (BioID/TurboID)Identifies transient interactions in cellular contextNon-specific labelingDiscovering contextual interactome
Split-ubiquitin assaySuited for membrane protein interactionsTechnical complexityValidating transmembrane domain interactions

Previous studies have successfully used immunoprecipitation to demonstrate that MARCH11 forms complexes with adaptor protein complex-1 and with fucose-containing glycoproteins in rat testis . These established interactions provide positive controls for validating new experimental approaches.

How can researchers assess the functional significance of MARCH11's PDZ binding motif?

To investigate the functional importance of MARCH11's PDZ binding motif that mediates interaction with Veli protein , researchers can employ several strategic approaches:

  • Mutation analysis: Generate MARCH11 constructs with point mutations or deletions in the PDZ binding motif and assess effects on:

    • Veli binding (co-immunoprecipitation)

    • Subcellular localization (immunofluorescence)

    • E3 ligase activity (ubiquitination assays)

    • Cargo sorting (trafficking assays)

  • Domain swapping: Replace the MARCH11 PDZ binding motif with equivalent domains from other proteins to assess specificity.

  • Competition assays: Introduce peptides mimicking the PDZ binding motif to competitively inhibit MARCH11-Veli interaction.

  • Structural studies: NMR or X-ray crystallography of the MARCH11 C-terminal region in complex with the Veli PDZ domain to understand interaction details.

When interpreting results from these experiments, researchers should consider that PDZ domain interactions can be regulated by post-translational modifications, which may add another layer of complexity to MARCH11 function.

How does MARCH11 compare structurally and functionally to other MARCH family members?

MARCH11 belongs to the membrane-associated RING-CH family of E3 ubiquitin ligases but displays distinctive features compared to other family members:

FeatureMARCH11Other MARCH ProteinsFunctional Implication
Tissue expressionPredominantly in developing spermatids, weakly in brain and pituitary Broader expression patterns (MARCH1, MARCH8)Specialized function in reproduction
Subcellular localizationTGN-derived vesicles and MVBs Plasma membrane, endosomes (MARCH1, MARCH8)Role in intracellular sorting rather than surface protein regulation
Binding partnersAP-1, Veli, fucose-containing glycoproteins MHC-II, CD86 (MARCH1)Different cargo selectivity
C-terminal motifsTyrosine-based motif, PDZ binding motif Variable C-terminal domainsUnique protein-protein interaction profile

These differences suggest MARCH11 has evolved specialized functions for spermatid development while maintaining the core E3 ligase mechanism characteristic of MARCH family proteins.

What experimental approaches can differentiate between functions of different MARCH proteins?

To distinguish MARCH11 functions from other MARCH family members, researchers can employ several strategic approaches:

  • Substrate specificity analysis: Compare ubiquitination targets of MARCH11 versus other MARCH proteins using proteomics and in vitro ubiquitination assays.

  • Domain swapping experiments: Create chimeric proteins exchanging domains between MARCH11 and other MARCH proteins to identify regions conferring functional specificity.

  • Tissue-specific rescue experiments: Test whether other MARCH proteins can compensate for MARCH11 deficiency in spermatid development.

  • Structural biology approaches: Compare binding sites and catalytic mechanisms through structural studies of multiple MARCH proteins.

When designing these experiments, researchers should account for potential redundancy among MARCH family members and consider that functional differences may be due to expression patterns rather than intrinsic biochemical properties.

What are recommended approaches for studying MARCH11's role in protein quality control during spermiogenesis?

Investigating MARCH11's potential function in protein quality control during spermatid development requires specialized experimental designs:

  • Identification of aberrant proteins in MARCH11-deficient spermatids: Proteomic comparison of wild-type versus MARCH11-knockout spermatids at different developmental stages.

  • Stress response analysis: Examination of unfolded protein response markers and ubiquitin-proteasome activity in MARCH11-deficient versus control spermatids.

  • Co-localization studies: Assessment of MARCH11 localization relative to misfolded protein markers during normal and stress conditions.

  • Substrate turnover assays: Pulse-chase experiments to measure protein half-lives in the presence and absence of functional MARCH11.

These approaches should be coordinated with detailed morphological analysis of developing spermatids to correlate molecular findings with structural development during spermiogenesis.

What methodological considerations are important when measuring MARCH11 expression levels across different experimental conditions?

Accurate quantification of MARCH11 expression requires careful attention to several methodological aspects:

  • Reference gene selection: For qPCR analysis, validate reference genes specifically stable in testicular tissue and across developmental stages. General housekeeping genes like GAPDH may not maintain consistent expression during spermatogenesis.

  • Antibody validation: Confirm MARCH11 antibody specificity using knockout controls and peptide competition assays, as cross-reactivity with other MARCH family members can confound results.

  • Stage-specific analysis: Isolate specific spermatogenic cell populations to avoid dilution effects from cells not expressing MARCH11.

  • Multiple detection methods: Combine qPCR, western blotting, and immunohistochemistry to obtain complementary measures of MARCH11 expression.

  • Consideration of protein half-life: Account for post-transcriptional regulation by examining both mRNA and protein levels, as they may not correlate directly.

When reporting expression data, researchers should clearly specify the detection methods, cell populations analyzed, and normalization strategies to enable accurate interpretation and reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.