Recombinant Rat E3 ubiquitin-protein ligase MARCH2 (41335)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Marchf2; March2; E3 ubiquitin-protein ligase MARCHF2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; RING-type E3 ubiquitin transferase MARCHF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
March2
Target Protein Sequence
MTTGDCCHLPGSLCDCSSSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSD CPFCRICHEGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPR PLTEWLKDPGPRTEKRTLCCDMVCFVFITPLAAISGWLCLRGAQDHLRLHSRLEAVGLIA LTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADGSEDPHHSLLATGLLKKV AEETPV
Uniprot No.

Target Background

Function
MARCH2 is an E3 ubiquitin-protein ligase that may mediate the ubiquitination of transferrin receptor (TFRC) and CD86, promoting their endocytosis and lysosomal degradation via multivesicular bodies. As an E3 ligase, MARCH2 accepts ubiquitin from an E2 ubiquitin-conjugating enzyme and transfers it to target substrates. It may also be involved in endosomal trafficking through its interaction with syntaxin 6 (STX6).
Gene References Into Functions
  1. MARCH2 depletion via siRNA disrupted the trans-Golgi network (TGN) localization of syntaxin 6 and TGN38/46. PMID: 15689499
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed. Present in liver (at protein level).

Q&A

What is MARCH2 and what are its primary functions?

MARCH2 (Membrane-associated RING-CH type finger 2) is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). It functions as an E3 ubiquitin-protein ligase that accepts ubiquitin from E2 ubiquitin-conjugating enzymes and transfers the ubiquitin to targeted substrates . MARCH2 mediates ubiquitination of various proteins including TFRC and CD86, promoting their subsequent endocytosis and sorting to lysosomes via multivesicular bodies . It also appears to be involved in endosomal trafficking through interaction with syntaxin 6 (STX6) .

How does recombinant rat MARCH2 protein differ from human MARCH2?

Recombinant rat MARCH2 shares significant sequence homology with human MARCH2, but species-specific variations exist. Rat MARCH2 (UniProt: Q5I0I2) is primarily used for research in rodent models while human MARCH2 is utilized in human cell line studies . When designing cross-species experiments, researchers should consider these differences, particularly when extrapolating findings from rat models to human applications. The rat model provides advantages for in vivo studies of MARCH2 function due to the availability of knockout models and established experimental protocols .

What roles does MARCH2 play in immune response regulation?

MARCH2 functions as a negative regulator of immune responses through multiple mechanisms:

  • It directly interacts with NEMO (NF-κB essential modulator) during the late stages of bacterial or viral infection

  • It catalyzes K48-linked polyubiquitination of NEMO at lysine 326, targeting it for proteasomal degradation

  • Through this mechanism, MARCH2 inhibits excessive antiviral and antibacterial innate immune responses

Experimental evidence from MARCH2-knockout mice showed:

  • Lower levels of viral replication and bacterial growth

  • Elevated expression of pro-inflammatory cytokines and type I interferons

  • Increased sensitivity to LPS-induced sepsis compared to wild-type mice

What is the evidence for MARCH2's role in cancer progression?

Studies have demonstrated that MARCH2 is significantly overexpressed in colorectal cancer (CRC) tissues compared to adjacent normal tissues. This overexpression correlates with several clinical parameters:

CharacteristicsStatistical Significance
Tumor sizeP = .008**
Pathological gradeP = .031*
Lymph node metastasisP = .001***
Survival timeNegatively correlated

MARCH2 appears to promote cancer progression through:

  • Enhancing cell invasion and migration capabilities

  • Facilitating epithelial-mesenchymal transition (EMT)

  • Negatively regulating E-cadherin expression (r = −0.265, P = .008)

How can MARCH2 be utilized in experimental research design?

When incorporating MARCH2 in research designs, consider:

  • Loss-of-function studies: Use siRNA or CRISPR-Cas9 to silence or knockout MARCH2 expression. In SW480 colorectal cancer cells, MARCH2 silencing significantly:

    • Reduced invasion and migration (demonstrated via Transwell and Scratch assays)

    • Upregulated E-cadherin and downregulated Vimentin (measured by qRT-PCR and Western blotting)

  • Gain-of-function studies: Overexpress wild-type or mutant MARCH2 to examine:

    • Effects on target protein degradation

    • Subcellular localization and trafficking

    • Impacts on signaling pathways

  • Protein interaction studies: Investigate MARCH2 binding partners through co-immunoprecipitation techniques, particularly focusing on its interaction with NEMO but not IKKα and IKKβ .

What are the optimal conditions for handling recombinant rat MARCH2 protein?

Based on manufacturer specifications and research protocols:

  • Storage: Store at -20℃ in Tris-based buffer with 50% glycerol; for extended storage, conserve at -80℃

  • Working conditions: Maintain working aliquots at 4℃ for up to one week

  • Stability: Stable for at least 6 months under proper storage conditions

  • Reconstitution: Suspend by gently pipetting down the sides of the vial without vortexing; allow several minutes for complete reconstitution

  • For prolonged storage: Dilute to working aliquots in a 0.1% BSA solution

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended

What experimental designs are most effective for studying MARCH2 function?

When designing experiments to study MARCH2 function, consider these approaches based on established research methodologies:

  • Matched-group design:

    • Separate participants (samples) into experimental and control groups, matched by important variables

    • For MARCH2 studies, this might involve matching cells or animal models by expression levels of key interaction partners

    • This design requires fewer participants while providing more accurate and informed results

  • True experimental designs vs. quasi-experimental designs:

    • True experimental designs involve random assignment and treatment manipulation

    • For in vitro MARCH2 studies, this could involve random assignment of cell cultures to different treatment conditions

    • This approach provides high internal validity for causality assessment

  • Field vs. laboratory experiments:

    • Laboratory experiments with MARCH2 offer high internal validity but potentially lower external validity

    • Consider cell type selection carefully to ensure relevance to the biological context being studied

How can I assess MARCH2's E3 ligase activity in experimental settings?

To evaluate MARCH2's E3 ligase activity:

  • Mutational analysis: Generate a MARCH2 W97A mutant, which abrogates the activity of the RING-CH domain. Compare effects of wild-type vs. mutant MARCH2 on target protein levels .

  • Ubiquitination assays: Detect K48-linked polyubiquitination of MARCH2 targets through immunoprecipitation followed by western blotting with ubiquitin-specific antibodies.

  • Proteasomal inhibition: Treat cells with proteasome inhibitors (e.g., MG132) to determine if MARCH2-mediated protein reduction is through the proteasomal degradation pathway.

  • Co-immunoprecipitation: Assess direct interaction between MARCH2 and potential target proteins, focusing particularly on NEMO interaction .

How should I design data collection for MARCH2-related research?

When designing data collection methods for MARCH2 research, consider:

  • Quantitative approaches:

    • Use well-defined metrics for protein expression (western blot, ELISA)

    • Apply systematic scoring systems for phenotypic outcomes

    • Consider statistical power during experimental design

  • Qualitative approaches:

    • Include open-ended questions in research protocols to capture unanticipated observations

    • Document detailed observations of cellular responses to MARCH2 manipulation

  • Mixed-methods approach:

    • Combine quantitative measurements with qualitative observations

    • Example: When measuring MARCH2's effect on cell migration, quantify migration rates while documenting morphological changes

How can I address contradictory findings in MARCH2 research?

When encountering contradictory findings:

  • Examine methodological differences:

    • Cell/tissue type differences: MARCH2 may function differently across cell types

    • Expression level variations: Overexpression vs. endogenous levels may yield different results

    • Timing considerations: MARCH2's effects may be temporally regulated during infection or cancer progression

  • Consider contextual factors:

    • Microenvironment influences on MARCH2 function

    • Presence of different binding partners in various experimental systems

    • Species-specific differences when comparing rat vs. human MARCH2 studies

  • Statistical analysis approaches:

    • Analyze within- and between-subjects effects separately

    • Consider selection effects in your sample that might bias results

    • Evaluate internal validity through convergent measurement approaches

What are the most appropriate controls when studying recombinant rat MARCH2?

Effective controls for MARCH2 studies include:

  • Negative controls:

    • Empty vector transfections for overexpression studies

    • Non-targeting siRNA for knockdown experiments

    • Wild-type cells/animals for knockout studies

  • Positive controls:

    • Known MARCH2 substrates like TFRC or CD86

    • Other MARCH family members with similar functions (e.g., MARCH8)

  • Functional controls:

    • RING domain mutants (W97A) to confirm E3 ligase dependency

    • Domain deletion mutants to assess structure-function relationships

    • Proteasome inhibitors to confirm degradation mechanisms

How does MARCH2 interact with other components of the ubiquitination pathway?

MARCH2's interactions within the ubiquitination pathway include:

  • E2 enzyme recruitment: MARCH2, like other RING-CH E3 ligases, recruits specific E2 ubiquitin-conjugating enzymes to facilitate ubiquitin transfer.

  • Target recognition specificity: MARCH2 exhibits selectivity for specific target proteins including:

    • TFRC (Transferrin receptor)

    • CD86 (T-cell costimulatory molecule)

    • NEMO (NF-κB essential modulator)

  • Ubiquitin chain specificity: MARCH2 preferentially generates K48-linked polyubiquitin chains on NEMO at lysine 326, directing it toward proteasomal degradation rather than other ubiquitin-dependent pathways .

What emerging applications exist for studying MARCH2 in disease models?

Emerging applications for MARCH2 research include:

  • MARCH2 as a therapeutic target:

    • For colorectal cancer: MARCH2 inhibition could potentially suppress tumor invasion and metastasis

    • For inflammatory conditions: Modulating MARCH2 activity could help control excessive immune responses

  • Biomarker development:

    • MARCH2 expression correlates with tumor size, pathological grade, and lymph node metastasis in CRC

    • It shows potential as an independent predictor for CRC patient outcomes

  • Drug resistance mechanisms:

    • EMT is an important mechanism mediating drug resistance in CRC

    • MARCH2's role in promoting EMT suggests it may influence drug resistance phenotypes

    • Further research on MARCH2's correlation with drug resistance could identify novel therapeutic strategies

What are common challenges when working with recombinant rat MARCH2?

Common challenges include:

  • Protein stability issues:

    • MARCH2, like many membrane proteins, can aggregate during purification

    • Solution: Use appropriate detergents and optimize buffer conditions

    • Avoid repeated freeze-thaw cycles

  • Expression level inconsistencies:

    • Variability in transfection efficiency

    • Solution: Use magnetic bead-coupled MARCH2 for consistent application

    • The pre-coupled magnetic beads provide uniform particle size and narrow size distribution with large surface area

  • Specificity of antibodies:

    • Cross-reactivity with other MARCH family members

    • Solution: Validate antibody specificity using MARCH2 knockout controls

    • Consider using tagged versions when antibody quality is a concern

How can I overcome difficulties in detecting subtle phenotypic effects of MARCH2?

To detect subtle MARCH2-mediated effects:

  • Employ sensitive assay systems:

    • Use reporter systems linked to MARCH2 targets

    • Implement high-content imaging for morphological changes

    • Consider single-cell analysis techniques to detect population heterogeneity

  • Time-course experiments:

    • MARCH2 effects may be transient or temporally regulated

    • Design experiments with multiple time points to capture dynamic changes

    • Compare early vs. late effects during infection or cellular stress responses

  • Combined readouts:

    • Integrate multiple experimental approaches (e.g., protein levels, localization, activity)

    • Correlate biochemical changes with functional outcomes

    • Use matched group design to reduce variability and increase statistical power

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.