Recombinant Rat E3 ubiquitin-protein ligase MARCH3 (41336)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Marchf3; March3; E3 ubiquitin-protein ligase MARCHF3; Membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; MARCH-III; RING-type E3 ubiquitin transferase MARCHF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
March3
Target Protein Sequence
MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLA TQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRF AVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRL EAVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILLIPKSVNIPSNQQSLLG LHSVKRNSKETIV
Uniprot No.

Target Background

Function

MARCH3 is a E3 ubiquitin-protein ligase potentially involved in endosomal trafficking. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme (via a thioester linkage) and directly transfer it to target substrates.

Database Links
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in lung, colon and spleen. Present in liver (at protein level).

Q&A

Basic Research Questions

  • What is MARCH3 and what is its role in cellular processes?

    MARCH3 (membrane-associated ring finger C3HC4 3) is a member of the MARCH family of E3 ubiquitin ligases characterized by a C4HC3-type RING domain that differs slightly from classic C3HC4-type RING domains in coordinating residues and peptide segment lengths . As an E3 ubiquitin ligase, MARCH3 facilitates the transfer of ubiquitin to target proteins, marking them for degradation or altered function. The MARCH family was initially identified as mammalian structural homologs of viral immunosuppressive membrane ubiquitin ligases K3 and K5 from Kaposi's sarcoma-associated herpesvirus . These proteins have emerged as critical regulators of immune responses, with functions in targeting immune receptors, viral proteins, and components of innate immune responses for polyubiquitination and degradation .

  • What are the key structural features of MARCH3?

    Rat MARCH3 contains several critical structural elements:

    • A distinctive N-terminal RING-CH domain responsible for its ubiquitin ligase activity

    • Transmembrane domains that anchor the protein to cellular membranes

    • Zinc-binding sites essential for proper folding and function of the RING domain

    • Specific domains involved in substrate recognition and binding

    The unique C4HC3-type RING domain coordinates zinc ions and interacts with E2 ubiquitin-conjugating enzymes to facilitate ubiquitin transfer to substrate proteins. This domain structure is critical for distinguishing MARCH proteins from other RING-finger E3 ligases and contributes to their specialized functions in membrane protein regulation.

  • What biochemical functions does MARCH3 mediate?

    According to the available data, MARCH3 demonstrates several key biochemical functions:

    FunctionRelated Function
    Ligase activityCatalyzes transfer of ubiquitin from E2 enzymes to target substrates
    Zinc ion bindingEssential for structural integrity and catalytic function of the RING domain

    MARCH3 participates in post-translational modification of proteins through ubiquitination, potentially regulating protein stability, trafficking, and function. The ligase activity allows MARCH3 to tag specific substrate proteins with ubiquitin, which can signal for their degradation via the proteasome or lysosomal pathways, or alter their cellular localization and activity.

Research Applications

  • How does MARCH3 contribute to immune regulation, based on studies of MARCH family proteins?

    The MARCH family of E3 ubiquitin ligases plays significant roles in immune regulation, as indicated by research on related family members:

    • MARCH proteins target immune receptors and components of innate immune responses for polyubiquitination and degradation via distinct routes .

    • These proteins were initially identified as mammalian homologs of viral immunosuppressive proteins that down-regulate MHC class I expression .

    • Through their ubiquitin ligase activity, MARCH proteins can modulate the surface expression and stability of immune receptors, affecting immune cell function and signaling.

    While the specific immune regulatory functions of MARCH3 are still being elucidated, its structural similarity to other MARCH family members suggests potential roles in immune receptor regulation. The unique substrate specificity of MARCH3, determined by its interaction partners and structural features, likely defines its specific contribution to immune regulation.

  • What parallels can be drawn between MARCH3 and other E3 ubiquitin ligases in host-pathogen interactions?

    E3 ubiquitin ligases play crucial roles in host-pathogen interactions, as exemplified by studies of other ubiquitin ligases:

    • Host E3 ubiquitin ligase ITCH has been shown to interact with Toxoplasma gondii effector protein GRA35, leading to NLRP1 inflammasome activation in rat macrophages .

    • ITCH-GRA35 interaction contributes to the restriction of Toxoplasma in human fibroblasts stimulated by IFNγ .

    • The recruitment of ITCH to the parasitophorous vacuole membrane is essential for parasite restriction, likely due to its role in recruiting ubiquitin and the parasite-restriction factor RNF213 .

    By analogy, MARCH3 may similarly be involved in recognizing pathogen components or modulating host defense pathways. Its membrane association positions it ideally to participate in the detection of membrane-disrupting pathogens or to regulate immune receptors involved in pathogen recognition. Future studies investigating MARCH3's role during infection could reveal similar mechanisms of effector-triggered immunity.

  • How can structural biology approaches advance our understanding of MARCH3 function?

    Structural biology techniques offer powerful insights into MARCH3 function:

    • X-ray crystallography or cryo-EM: To determine the three-dimensional structure of MARCH3's RING domain in complex with E2 enzymes or substrates.

    • NMR spectroscopy: For analyzing the dynamics of MARCH3-substrate interactions and conformational changes during catalysis.

    • Hydrogen-deuterium exchange mass spectrometry: To map interaction surfaces and conformational changes upon binding partners.

    • Molecular dynamics simulations: To model how MARCH3 recognizes and positions substrates for ubiquitin transfer.

    Structural information would reveal:

    • The molecular basis for E2 enzyme selection

    • Mechanisms of substrate recognition

    • Conformational changes during the catalytic cycle

    • Potential sites for therapeutic intervention

    These approaches would complement functional studies and provide a mechanistic understanding of MARCH3's role in cellular processes.

  • What are the implications of MARCH3 research for understanding neurodegenerative diseases?

    While the provided search results don't directly address MARCH3 in neurodegenerative contexts, E3 ubiquitin ligases broadly play critical roles in protein quality control and homeostasis in neurons:

    • Protein aggregation, a hallmark of many neurodegenerative diseases, often results from defects in ubiquitin-mediated protein degradation.

    • Membrane protein trafficking and turnover, which may be regulated by MARCH3, are essential for synaptic function and neuronal health.

    • E3 ligases can target misfolded proteins for degradation, preventing toxic accumulation.

    Research approaches to investigate MARCH3's potential role in neurodegeneration include:

    • Expression profiling in neural tissues and in disease models

    • Identification of neuronal substrates using proteomics

    • Assessment of MARCH3 polymorphisms in patient populations

    • Evaluation of MARCH3 activity in animal models of neurodegeneration

    Understanding MARCH3's function in neurons could reveal new therapeutic targets for conditions characterized by protein homeostasis dysregulation.

  • How can computational approaches be integrated with experimental studies to predict MARCH3 substrates?

    Computational biology offers powerful tools to complement experimental MARCH3 research:

    • Sequence-based predictions: Using machine learning algorithms trained on known E3-substrate pairs to predict potential MARCH3 targets based on sequence features.

    • Structural modeling: Employing homology modeling and protein-protein docking to predict MARCH3-substrate interactions.

    • Network analysis: Integrating protein interaction networks, co-expression data, and subcellular localization information to identify likely MARCH3 substrates.

    • Evolutionary conservation analysis: Identifying conserved potential recognition motifs in putative substrates across species.

    • Systems biology approaches: Integrating multiple omics datasets to identify proteins whose abundance or modification state changes with MARCH3 manipulation.

    An integrated computational-experimental workflow might involve:

    1. Computational prediction of candidate substrates

    2. Experimental validation using in vitro ubiquitination assays

    3. Cellular studies to confirm physiological relevance

    4. Structural studies to define interaction interfaces

    This iterative approach can accelerate discovery of authentic MARCH3 substrates and their biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.