Recombinant Rat E3 ubiquitin-protein ligase RNF152 (Rnf152)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Rat E3 ubiquitin-protein ligase RNF152 (Rnf152), also known as Ring finger protein 152, is an E3 ubiquitin ligase containing a RING domain and a transmembrane (TM) domain . In humans, the gene that encodes this protein is named RNF152 . RNF152 participates in different signaling pathways and cellular processes .

Gene Information

CharacteristicDescription
Official gene symbolRNF152
Full gene nameRing finger protein 152
Protein classE3 ubiquitin ligase
LocationThe protein is predicted to be intracellular. It may be secreted, but this is overruled by annotation data indicating an intracellular location .
FunctionCapable of binding small GTPases and has ubiquitin-protein ligase activity .

Function and Mechanism

RNF152 functions as an E3 ubiquitin ligase, which mediates the transfer of ubiquitin to target proteins, influencing their stability, function, or localization. RNF152 is involved in:

  • Regulation of inflammatory response RNF152 positively regulates TLR/IL-1R-mediated inflammatory response by facilitating oligomerization of MyD88, which subsequently promotes the assembly of Myddosome . RNF152 is essential for TLR/IL-1R-mediated, MyD88-dependent signal transduction .

  • Regulation of mTORC1 signaling RNF152 acts as a negative regulator of mTORC1 signaling by mediating ubiquitination of RagA/RRAGA and RHEB .

  • Regulation of TLR/IL-1R signaling RNF152 positively regulates TLR/IL-1R signaling by enhancing MyD88 oligomerization .

RNF152 has been identified as a regulator of IL-1β signaling through screening of human cDNA expression clones . Overexpression of RNF152 can activate the NF-κB reporter in a dose-dependent manner and enhance IL-1β-triggered NF-κB activation . It also enhances the transcription of inflammatory cytokines induced by IL-1β .

RNF152 and Inflammatory Response

RNF152 plays a role in MyD88-dependent signaling pathways, which are crucial for the inflammatory response . Studies using RNF152-deficient mice have shown that RNF152 is required for IL-1R-, TLR2-, and TLR4-mediated signaling, but not TLR3-mediated signaling .

Experiments have demonstrated that RNF152-deficient mice produce fewer inflammatory cytokines in response to LPS and are more resistant to LPS-induced lethal endotoxemia . The production of IL-6 and TNFα induced by LPS was significantly decreased in RNF152-deficient mice, whereas IFN-β production, which is mediated by TRIF-dependent signaling, was not affected .

RNF152 and Disease

  • Endotoxemia RNF152-deficient mice exhibit delayed onset of death and reduced lethality compared to wild-type mice after LPS challenge, suggesting RNF152's role in TLR/IL-1R-mediated inflammatory responses .

  • Cancer RNF152 expression and function in cancer are not well-documented in the provided. Further research may be needed to elucidate its specific involvement in cancer development or progression .

  • Other diseases RNF152 may play a role in additional diseases or conditions, but this is not detailed in the provided. Further studies could explore its involvement in other pathological states .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. To prioritize a specific tag, please inform us during your order.
Synonyms
Rnf152; E3 ubiquitin-protein ligase RNF152; RING finger protein 152; RING-type E3 ubiquitin transferase RNF152
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERTLLPGDMGCR LLPGSQQKSLTVVTIPAEQQPLQGGAPQEAVEEEPDRRGVAKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG
Uniprot No.

Target Background

Function

Recombinant Rat E3 ubiquitin-protein ligase RNF152 (Rnf152) is an E3 ubiquitin-protein ligase that mediates Lys-63-linked polyubiquitination of RRAGA in response to amino acid starvation. This regulates mTORC1 signaling and influences cellular responses to amino acid availability. RNF152 also mediates Lys-48-linked polyubiquitination of target proteins, leading to proteasomal degradation. Overexpression of RNF152 induces apoptosis.

Database Links
Protein Families
RNF152 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.