Recombinant Rat E3 ubiquitin-protein ligase RNF182 (Rnf182)

Shipped with Ice Packs
In Stock

Description

E3 Ubiquitin Ligase Activity

RNF182 facilitates K48-linked polyubiquitination of substrate proteins, targeting them for proteasomal degradation. Key substrates include:

SubstrateFunction of DegradationImplicationsSource
ATP6V0CComponent of gap junctions and neurotransmitter release channelsDisrupted cellular homeostasis in Alzheimer’s disease
RELA (NF-κB p65)Transcription factor for proinflammatory cytokinesInhibition of TLR-triggered inflammation

Regulatory Pathways

  • Neurodegeneration: Upregulated in Alzheimer’s disease (AD) brains and neuronal injury models, promoting ATP6V0C degradation and contributing to synaptic dysfunction .

  • Immune Modulation: Inhibits TLR signaling by degrading RELA, reducing proinflammatory cytokine production (e.g., TNF-α, IL-6) in macrophages .

Experimental Uses

  1. Proteasomal Degradation Assays:

    • Used to study ATP6V0C ubiquitination in vitro and validate its role in AD pathology .

  2. Immune Response Studies:

    • Knockdown or overexpression in macrophages to assess TLR signaling and cytokine production .

  3. Antibody Validation:

    • Control fragment (aa 36–177) blocks anti-RNF182 antibodies in Western blot and IHC assays .

ApplicationMethodologyOutcomeSource
Substrate IdentificationCo-precipitation, yeast two-hybrid assaysATP6V0C interaction confirmed
Immune RegulationTLR4/TLR3/TLR9 stimulation in macrophages with RNF182 knockdownElevated cytokine production
Antibody SpecificityPre-incubation with recombinant fragmentNeutralization of antibody signals

Comparative Analysis with Related E3 Ligases

RNF182 belongs to the RNF183 family (RNF183, RNF186, RNF152), which share tissue-specific expression and lysosomal localization.

E3 LigaseTissue ExpressionKey Substrate/FunctionDisease AssociationSource
RNF182Brain, macrophagesATP6V0C, RELAAlzheimer’s, immune dysregulation
RNF183Kidney, colonNa⁺,K⁺-ATPase β1 subunitHypertonic stress, IBD, cancer
RNF186Intestine, liverMammalian target of rapamycin (mTOR)Metabolic disorders

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rnf182; E3 ubiquitin-protein ligase RNF182; RING finger protein 182; RING-type E3 ubiquitin transferase RNF182
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Rnf182
Target Protein Sequence
MASQPPEEPAEFQVSDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQG VIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGSKGKKCLPENPTELLLTPKRLASLVS PSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQT SIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFL DCMALPS
Uniprot No.

Target Background

Function

RNF182 is an E3 ubiquitin-protein ligase that mediates the ubiquitination and subsequent proteasomal degradation of ATP6V0C. It also plays a role in inhibiting TLR-triggered innate immune responses by mediating Lys-48-linked ubiquitination and degradation of the NF-κB component RELA.

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is RNF182 and what is its primary function in cellular processes?

RNF182 is a brain-enriched E3 ubiquitin ligase containing a RING finger domain. It functions primarily to catalyze the transfer of ubiquitin to target proteins, marking them for degradation via the ubiquitin-proteasome pathway. RNF182 exhibits substrate-independent, E2-dependent E3 ubiquitin ligase activity, as demonstrated by in vitro ubiquitination assays . The protein consists of 247 amino acids with a calculated molecular mass of 27.4 kDa and is highly conserved across species, with human RNF182 showing 98% and 97% sequence identity to mouse and rat orthologs, respectively .

How is RNF182 expression regulated in different tissue types?

RNF182 shows tissue-specific expression patterns with predominant expression in neural tissues. Quantitative RT-PCR analysis has demonstrated that RNF182 is a brain-enriched gene, with significant expression detected in the mouse cortex, hippocampus, cerebellum, and spinal cord, but not in non-neural tissues such as heart, liver, kidney, or skeletal muscle . Additionally, RNF182 expression increases during retinoic acid-induced differentiation of human NT2 cells, with elevated levels observed in both NT2 neurons and NT2 astrocytes .

What is known about the transcriptional regulation of RNF182?

RNF182 has two alternatively spliced transcripts that share the same open reading frame. Genomic analysis has revealed that the RNF182 gene consists of four exons, with alternative splicing occurring through the swapping of exons 1 and 2 . This alternative splicing affects the 5' untranslated region but produces the same protein. In certain pathological conditions, RNF182 transcription can be altered - for example, in non-small cell lung cancer (NSCLC), RNF182 expression is suppressed through abnormal hypermethylation and AhR-dependent transcriptional regulation .

How does RNF182 function as an E3 ubiquitin ligase at the molecular level?

RNF182 functions as a substrate-independent, E2-dependent E3 ubiquitin ligase through its RING finger domain. In vitro ubiquitination assays have demonstrated that RNF182 can catalyze the formation of high molecular weight ubiquitin chains in reaction mixtures containing ubiquitin, E1, E2, and RNF182 itself . This activity is strictly dependent on the presence of all components, as reactions omitting E1, E2, or ubiquitin showed negative results. Unlike some E3 ligases, RNF182 does not show apparent auto-ubiquitination, suggesting it primarily mediates the ubiquitination of other proteins .

ComponentRequired for ActivityRole in Ubiquitination Reaction
RNF182YesCatalyzes transfer of ubiquitin from E2 to substrate
E1YesActivates ubiquitin in ATP-dependent manner
E2YesCarries activated ubiquitin to E3 ligase
UbiquitinYesTarget molecule for protein modification
ATPYesRequired for ubiquitin activation

What are the known protein-protein interactions of RNF182?

Research has identified several key protein-protein interactions for RNF182:

  • ATP6V0C: Yeast two-hybrid screening, overexpression, and co-precipitation approaches have demonstrated that RNF182 interacts with ATP6V0C both in vitro and in vivo . This interaction facilitates the degradation of ATP6V0C via the ubiquitin-proteasome pathway.

  • p65 (NF-κB subunit): RNF182 interacts with p65 and promotes its K48-linked ubiquitination and subsequent degradation . This interaction is particularly important in the regulation of inflammatory responses and cancer progression.

  • RING domain-independent interactions: Studies have shown that the RING finger domain is not essential for RNF182's interaction with ATP6V0C, suggesting that RNF182 may have structural domains dedicated to protein-protein interactions separate from its catalytic function .

How does RNF182 regulate cellular signaling pathways?

RNF182 functions as a negative regulator of several signaling pathways:

  • NF-κB signaling: RNF182 inhibits NF-κB signaling by promoting the degradation of p65 via K48-linked ubiquitination . This mechanism serves as a negative feedback loop to terminate NF-κB-mediated inflammatory responses.

  • TLR signaling: RNF182 is specifically upregulated by TLR stimuli (TLR4, TLR3, and TLR9 agonists) and selectively inhibits the production of proinflammatory cytokines but not type I interferons in macrophages . This represents a feedback-negative mechanism for controlling TLR-induced inflammation.

  • PDL1 transcription: In lung adenocarcinoma, RNF182 affects PDL1 transcription through its regulation of p65, potentially influencing immune evasion mechanisms .

What is the role of RNF182 in neurological disorders?

RNF182 expression is significantly upregulated in Alzheimer's disease (AD) brains and in neuronal cells subjected to cell death-inducing injuries . Quantitative RT-PCR analysis confirmed higher RNF182 transcript levels in AD brain samples compared to age-matched controls. Furthermore, RNF182 expression is increased in post-mitotic NT2 neurons subjected to oxygen and glucose deprivation (OGD), a condition that triggers neuronal cell death .

The overexpression of RNF182 in N2a cells accelerates cell death, suggesting that RNF182 can disrupt cellular homeostasis and potentially contribute to neurodegeneration . These findings indicate that RNF182 might play a role in the progression of AD and other neurodegenerative conditions through mechanisms related to its E3 ubiquitin ligase activity and interaction with specific neuronal proteins.

How is RNF182 expression altered in cancer, particularly in lung cancer?

RNF182 exhibits significantly decreased expression in lung cancer tissues:

Sample TypeRNF182 ExpressionMethylation StatusCorrelation with Prognosis
LUAD tissuesDecreasedHypermethylatedPoor prognosis with low expression
LUSC tissuesDecreasedHypermethylatedNo significant correlation
Normal lung tissueNormalLow methylationN/A

How does RNF182 affect cancer cell proliferation and immune evasion?

RNF182 has demonstrated tumor suppressor properties in lung cancer models:

  • Cell proliferation: Knockdown of RNF182 in PC9 cells significantly increased cell colony formation and proliferation, suggesting that RNF182 naturally inhibits these processes .

  • Cell cycle regulation: RNF182 knockdown reversed the induction of cell cycle arrest in G1 phase, indicating a role for RNF182 in cell cycle regulation .

  • Immune evasion: RNF182 induces p65 ubiquitination, affecting PDL1 transcription and potentially suppressing immune evasion in lung adenocarcinoma . This suggests that loss of RNF182 in cancer cells might promote immune evasion through increased PDL1 expression.

What are the recommended methods for studying RNF182 ubiquitination activity?

To study RNF182 ubiquitination activity, researchers should consider the following methodological approaches:

  • In vitro ubiquitination assays: Combine recombinant His-tagged or GST-tagged RNF182 with E1, E2, ubiquitin, and ATP in a suitable buffer system. Analyze the formation of high molecular weight ubiquitin chains using Western blotting with anti-ubiquitin antibodies .

  • Substrate identification: Employ yeast two-hybrid screening, co-immunoprecipitation, and mass spectrometry approaches to identify potential substrates of RNF182 .

  • Ubiquitination site mapping: Use site-directed mutagenesis of lysine residues in potential substrates followed by in vitro or in vivo ubiquitination assays to map specific ubiquitination sites .

  • Chain-specific ubiquitination analysis: Use antibodies specific for different ubiquitin linkages (K48, K63, etc.) to determine the type of ubiquitin chains formed by RNF182 on its substrates .

What experimental approaches are effective for analyzing RNF182 expression and regulation?

For comprehensive analysis of RNF182 expression and regulation, consider these approaches:

  • Transcriptional analysis:

    • Quantitative RT-PCR for mRNA expression levels

    • RNA-seq for genome-wide expression analysis and alternative splicing detection

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors regulating RNF182

  • Protein expression analysis:

    • Western blotting using specific antibodies against RNF182

    • Immunohistochemistry for tissue localization and expression patterns

    • Immunofluorescence for subcellular localization

  • Epigenetic regulation:

    • Bisulfite genomic sequencing (BGS) to analyze CpG methylation status of the RNF182 promoter

    • Methylation-specific PCR

    • Treatment with demethylating agents to assess reversibility of methylation-induced silencing

How can researchers effectively manipulate RNF182 expression for functional studies?

Several approaches can be employed to manipulate RNF182 expression for functional studies:

  • Overexpression systems:

    • Transfection of expression vectors containing RNF182 cDNA (with or without tags such as His, FLAG, or EGFP)

    • Stable cell line generation using antibiotic selection

    • Inducible expression systems for temporal control

  • Knockdown/knockout approaches:

    • RNA interference using specific shRNAs or siRNAs targeting RNF182

    • CRISPR-Cas9 genome editing for complete knockout

    • Antisense oligonucleotides for transient knockdown

  • Domain-specific mutants:

    • Site-directed mutagenesis of critical residues in the RING finger domain to create catalytically inactive mutants

    • Deletion mutants to identify functional domains required for protein-protein interactions

    • Point mutations in putative phosphorylation or other post-translational modification sites

What are the advanced techniques for studying RNF182's role in disease models?

For studying RNF182 in disease contexts, consider these advanced approaches:

  • In vitro disease models:

    • Oxygen-glucose deprivation (OGD) treatment of neuronal cells to model ischemic conditions

    • β-amyloid peptide treatment combined with OGD to model Alzheimer's disease conditions

    • TLR agonist stimulation to study inflammatory responses

  • In vivo models:

    • Transgenic mouse models with conditional RNF182 expression or knockout

    • Xenograft models for cancer studies with RNF182-modulated cells

    • Neurodegeneration models for studying RNF182's role in neurological disorders

  • Patient-derived systems:

    • Analysis of RNF182 expression in patient samples using tissue microarrays

    • Patient-derived xenografts

    • Single-cell analysis of RNF182 expression in heterogeneous tissue samples

How does RNF182 interact with other ubiquitination pathway components?

Recent studies suggest that RNF182 functions within a complex network of ubiquitination pathway components:

  • E2 enzyme specificity: While RNF182 has been shown to function with certain E2 enzymes in vitro, the specific E2 enzymes it preferentially interacts with in vivo require further investigation .

  • Deubiquitinating enzyme interactions: The potential interplay between RNF182 and deubiquitinating enzymes that might counteract its activity remains an important area for future research.

  • Ubiquitin chain specificity: Current evidence suggests RNF182 may preferentially catalyze K48-linked ubiquitination in the case of p65 , but its specificity for other types of ubiquitin chains and their functional significance requires additional study.

What are the contradictions in current research on RNF182 function?

Several areas of RNF182 research present contradictory or incomplete findings:

  • Tissue-specific roles: While RNF182 appears to have tumor-suppressive functions in lung cancer , its upregulation in Alzheimer's disease suggests potential pro-apoptotic functions in neuronal contexts . This apparent contradiction may reflect tissue-specific roles that warrant further investigation.

  • Target specificity: Current research has identified only a few targets (ATP6V0C, p65) for RNF182-mediated ubiquitination . A more comprehensive understanding of its substrate repertoire is needed to fully elucidate its cellular functions.

  • Regulation mechanisms: While transcriptional upregulation of RNF182 has been observed in response to certain stimuli (RA-induced differentiation, TLR stimulation), the precise mechanisms governing its expression and activity remain incompletely understood .

What emerging therapeutic opportunities involve targeting RNF182?

The involvement of RNF182 in multiple disease contexts suggests several potential therapeutic avenues:

  • Cancer therapeutics: Given its tumor-suppressive role in lung cancer, strategies to restore RNF182 expression or function, such as demethylating agents targeting its promoter, could represent a novel therapeutic approach .

  • Immunomodulation: RNF182's role in regulating inflammatory responses through p65 ubiquitination suggests potential applications in inflammatory diseases by modulating its activity .

  • Neurodegenerative diseases: Understanding RNF182's role in neurodegeneration might provide insights for therapeutic interventions in Alzheimer's disease and other neurological disorders .

  • Small molecule modulators: Development of small molecules that could enhance or inhibit RNF182's E3 ligase activity depending on the disease context represents an intriguing future direction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.