Recombinant Rat E3 ubiquitin-protein ligase RNF5 (Rnf5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat E3 Ubiquitin-Protein Ligase RNF5 (Rnf5)

Recombinant Rat E3 ubiquitin-protein ligase RNF5, commonly referred to as Rnf5, is an enzyme that functions as an E3 ubiquitin ligase within the ubiquitin modification system . RNF5 contains a classic RING domain that confers ligase activity and is anchored to the endoplasmic reticulum (ER) membrane via a single transmembrane (TM) domain located in the C-terminal region . RNF5 is involved in several physiological processes, including protein localization and cancer progression .

RNF5 in Antiviral Immunity

RNF5 acts as a negative regulator of antiviral innate immunity, which is the host’s first line of defense against virus infections . It functions in the K48-linked ubiquitination and degradation of STING and MAVS, which are essential adaptor proteins that resist DNA and RNA viral infections, respectively, as well as their downstream signal IRF3 .

RNF5 regulates the stability and function of both STING and MAVS . It promotes the ubiquitination and subsequent degradation of STING, limiting the duration and magnitude of STING-dependent immune responses, and promotes the degradation of MAVS through ubiquitination, thus dampening the downstream signaling events triggered by MAVS during viral infections . Dysregulation of RNF5-mediated regulation of STING and MAVS can lead to compromised immune responses, potentially increasing viral replication and pathogenesis .

Several host factors collaborate with RNF5 to regulate innate immunity. For instance, RNF26, REC8, iRhom2, and miR-483-3p inhibit the degradation of STING or MAVS triggered by RNF5 via various mechanisms, maintaining the stabilities of signaling proteins and promoting the antiviral innate immune response . Conversely, JMJD6 contributes to IRF3 degradation in an RNF5-dependent way, achieving an opposite effect .

RNF5 and Viral Infections

VirusRNF5 RoleMechanism
SARS-CoV-2Facilitates viral assembly, budding, and release Mediates K63-linked ubiquitination of the M protein, enhancing its interaction with the E protein and facilitating virion release; also targets ORF3a and E proteins for ubiquitination, suppressing SARS-CoV-2 replication and infection .
Herpes Simplex VirusLimits the type I IFN antiviral response Inhibits STING/IRF3 signaling .
Influenza A VirusHijacked by PB1 protein to degrade MAVS Catalyzes polyubiquitination of MAVS for autophagosomal and proteasomal degradation .
Newcastle DiseaseHijacked by V protein to degrade MAVS Catalyzes polyubiquitination of MAVS for autophagosomal and proteasomal degradation .

RNF5 and Cancer

RNF5 is implicated in cancer progression and is highly expressed in breast cancer and melanoma . In acute myeloid leukemia (AML), increased RNF5 abundance correlates with poor prognosis . RNF5 regulates glutamine metabolism by promoting the degradation of misfolded glutamine carrier proteins, a function important in cancer cell survival .

RNF5 as a Therapeutic Target

RNF5 is considered an emerging target for antiviral therapy as it facilitates virion release by mediating the ubiquitin modification of SARS-CoV-2 M . An RNF5 agonist, Analog-1, effectively inhibits SARS-CoV-2 infection in both cells and mouse infection models . Inhibiting RNF5 could enhance antiviral immune responses and combat viral infections .

Regulation of STING and MAVS

RNF5 promotes the degradation of STING, suggesting it as a potential target for treating pathological conditions such as cardiac hypertrophy . Several host factors regulate MAVS and immune responses by targeting RNF5. RNA viruses also exploit RNF5 to degrade MAVS .

Experimental Findings

Silencing RNF5 in human corneal epithelial cells (HCECs) inhibits the expression of IFN-β through the STING/IRF3 signaling pathway . Overexpression of RNF5 in HCECs also inhibits the expression of IFN-β mRNA . Silencing RNF5 alleviates herpes simplex keratitis (HSK) severity in mice, reducing viral titers in tears and improving clinical scores .

RNF5 and ERAD

RNF5, originally identified as an ER-anchored ubiquitin ligase involved in ERAD, is also targeted to the mitochondria . It plays a role in the recognition and ubiquitination of misfolded proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Rnf5; E3 ubiquitin-protein ligase RNF5; RING finger protein 5; RING-type E3 ubiquitin transferase RNF5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-180
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
AAAEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDR QECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFH FSFGVGAFPFGFFTTVFNAHEPFRRGAGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Uniprot No.

Target Background

Function
Recombinant Rat E3 ubiquitin-protein ligase RNF5 (Rnf5) exhibits E2-dependent E3 ubiquitin-protein ligase activity. It may function in conjunction with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. RNF5 mediates the ubiquitination of PXN/paxillin and may be involved in regulating cell motility and PXN/paxillin localization. Furthermore, it mediates Lys-63-linked polyubiquitination of JKAMP, thereby modulating JKAMP function by reducing its association with proteasome and ERAD components; this ubiquitination appears to involve the E2 ubiquitin-conjugating enzyme UBE2N. Finally, RNF5 mediates Lys-48-linked polyubiquitination of STING1 at Lys-150, leading to its proteasomal degradation; this ubiquitination occurs in mitochondria following viral transfection and regulates antiviral responses.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion membrane. Endoplasmic reticulum membrane.

Q&A

What is the molecular structure and basic function of RNF5?

RNF5 is an E3 ubiquitin ligase that contains a classic RING domain conferring its ligase activity. The protein is anchored to the endoplasmic reticulum (ER) membrane through a single transmembrane domain located within the C-terminal region . RNF5's primary function is to facilitate the ubiquitination of target proteins, marking them for degradation through the ubiquitin-proteasome system (UPS).

RNF5 can mediate different types of polyubiquitination, including K48-linked chains that typically signal for proteasomal degradation and K63-linked chains that often mediate signaling functions. This versatility in ubiquitination patterns allows RNF5 to regulate diverse cellular processes, from protein quality control to signal transduction. When designing experiments with recombinant rat RNF5, it's essential to consider whether the protein should retain its membrane-anchoring domain, as this affects its localization and function in cellular assays.

In knockout models, RNF5-deficient mice exhibit altered ER stress responses, suggesting its importance in maintaining ER homeostasis . RNF5 knockout animals have been generated by replacing the first 3 exons of the Rnf5 gene with a Neomycin cassette, resulting in complete loss of RNF5 protein expression .

What are the principal substrates of RNF5 and their biological significance?

RNF5 targets multiple substrates across different cellular pathways, making it a key regulator of diverse biological processes:

SubstrateUbiquitination TypeBiological Significance
F508del-CFTRK48-linkedTargets mutant CFTR for degradation, contributing to cystic fibrosis pathogenesis
STINGK48-linkedNegatively regulates STING-dependent antiviral immune responses
MAVSK48-linkedRegulates innate immune responses to viral infections
SARS-CoV-2 E proteinK48-linkedLeads to E protein degradation, restricting viral replication
SARS-CoV-2 M proteinK63-linked (K15 site)Promotes M-E complex formation, facilitating viral assembly and release

The diversity of RNF5 substrates highlights its importance in multiple cellular processes. For CFTR regulation, RNF5 knockout in F508del-CFTR mice improved intestinal absorption, demonstrating potential therapeutic relevance . In viral infections, RNF5 plays a dual role - it restricts SARS-CoV-2 replication by degrading the E protein, but it also facilitates viral assembly by modifying the M protein .

For researchers investigating these pathways, it's important to note that RNF5 can mediate different types of ubiquitin linkages depending on the substrate, which have distinct functional outcomes. Experimental approaches should be designed to distinguish between these different ubiquitination patterns.

What experimental systems are optimal for studying RNF5 function?

Several experimental systems have proven effective for investigating RNF5 function:

Cellular Models:

  • CFBE41o- cells (bronchial epithelial cells) for studying RNF5's role in CFTR regulation

  • Corneal epithelial cells for examining RNF5 in viral infections (particularly HSV-1)

  • HEK293T cells for reconstitution of ubiquitination pathways and protein-protein interaction studies

Animal Models:

  • RNF5 knockout mice (Rnf5-/-) show delayed activation of ER stress markers compared to wild-type

  • F508del-CFTR mice crossed with RNF5 knockout mice demonstrate improved intestinal function

  • RNF5 transgenic mice with inducible expression systems show muscle wasting when RNF5 is overexpressed

Biochemical Approaches:

  • In vitro ubiquitination assays using purified components to identify substrates and ubiquitination patterns

  • Co-immunoprecipitation to detect RNF5-substrate interactions

  • Proximity ligation assays to detect interactions in intact cells

When designing experiments with recombinant rat RNF5, researchers should consider using inducible expression systems to control protein levels, as high constitutive expression of E3 ligases can disrupt cellular ubiquitination networks. Additionally, including appropriate controls in ubiquitination assays is essential:

  • Reactions lacking ATP (required for ubiquitination)

  • Reactions with catalytically inactive RNF5 mutants

  • Reactions with ubiquitin mutants (e.g., K48R, K63R) to determine linkage specificity

How does RNF5 expression pattern vary across tissues and disease states?

RNF5 expression patterns vary across different tissues and can be significantly altered in disease states:

Normal Tissue Expression:

  • Constitutively expressed in corneal tissues

  • Present in muscle tissue where it plays a role in normal physiology

  • Expressed at different levels across age groups, which may influence disease susceptibility

Disease-Associated Expression Changes:

  • Increased expression in corneal tissues during HSV-1 infection

  • Upregulated and mislocalized to protein aggregates in muscles from sporadic inclusion body myositis (sIBM) patients

  • Expression levels vary in COVID-19 patients with different disease severity, suggesting potential as a prognostic marker

For researchers studying tissue-specific functions of RNF5, it is important to establish baseline expression levels in control tissues before examining changes in disease models. Common techniques for analyzing RNF5 expression include qRT-PCR for mRNA expression, Western blotting for protein levels, and immunohistochemistry for localization in tissue sections.

When analyzing RNF5 expression in tissues from disease models, attention should be paid not only to expression levels but also to potential changes in subcellular localization, as mislocalization can significantly impact function even without changes in expression level.

What approaches can be used to modulate RNF5 activity in experimental settings?

Researchers have several options for modulating RNF5 activity in experimental systems:

Genetic Approaches:

  • RNF5 silencing using siRNA or shRNA for transient knockdown

  • CRISPR/Cas9-mediated knockout for complete elimination of RNF5

  • Overexpression of wild-type vs. mutant RNF5 (e.g., RING domain mutants)

  • Inducible expression systems to control timing and level of RNF5 expression

Pharmacological Modulators:

  • FX12, a benzo[b]thiophene derivative that acts as both an inhibitor and degrader of RNF5

  • Analog-1, an RNF5 pharmacological activator shown to alleviate disease in a SARS-CoV-2 infection model

Experimental Design Considerations:

  • For genetic approaches, include appropriate controls (scrambled siRNA, empty vector)

  • For pharmacological modulators, establish clear dose-response relationships

  • Consider combination approaches (e.g., RNF5 inhibition plus CFTR correctors like VX-809)

  • Validate target engagement using biochemical assays (e.g., measuring substrate ubiquitination)

Each approach has advantages and limitations. Genetic knockdown or knockout provides specificity but may trigger compensatory mechanisms. Pharmacological modulation allows for temporal control and potential therapeutic applications but may have off-target effects. The choice of approach should be guided by the specific research question and experimental system.

How does RNF5 regulate CFTR trafficking and function in cystic fibrosis models?

RNF5 plays a significant role in the regulation of mutant CFTR in cystic fibrosis, particularly the common F508del-CFTR variant. This regulation involves specific trafficking pathways and has important implications for therapeutic approaches.

RNF5 acts as a quality control factor in the ER that recognizes and ubiquitinates misfolded F508del-CFTR, targeting it for degradation through the ubiquitin-proteasome system. Studies using RNF5 knockout mice crossed with F508del-CFTR transgenic mice have provided compelling evidence for this role:

  • RNF5 knockout F508del-CFTR mice exhibited improved intestinal absorption compared to animals expressing wild-type RNF5

  • This improvement was demonstrated by reduced frequency of animals with severely decreased body weight and reduced fecal excretion of biliary acids

The regulation of F508del-CFTR by RNF5 involves GRASP-dependent unconventional trafficking pathways:

  • GRASP65 plays a crucial role in the unconventional trafficking of F508del-CFTR

  • GRASP65 suppression significantly decreases the extent of CFTR rescue obtained following combined RNF5 silencing and VX-809 treatment

  • GRASP55 silencing was less effective, indicating that in bronchial epithelial cells, GRASP65 is the primary protein functioning in unconventional F508del-CFTR trafficking

These findings point to RNF5 as a potential therapeutic target for cystic fibrosis treatment, particularly in combination with existing CFTR correctors. The table below summarizes key experimental approaches for studying RNF5-CFTR interactions:

ApproachMethodologyKey Readouts
Cell-Based AssaysCFBE41o- cells, electrophysiology, surface biotinylationCFTR channel function, plasma membrane CFTR levels
Animal Model StudiesF508del-CFTR mice with/without RNF5Body weight, intestinal function, biliary acid excretion
Molecular TechniquesCo-IP, ubiquitination assays, siRNA knockdownRNF5-CFTR interaction, ubiquitination patterns

What is the dual role of RNF5 in viral pathogenesis and antiviral immunity?

RNF5 exhibits a fascinating dual role in viral infections, functioning both as an antiviral factor and as a target that can be exploited by viruses for immune evasion. This duality makes RNF5 a complex but promising target for antiviral strategies.

RNF5 as a Negative Regulator of Antiviral Immunity:

RNF5 suppresses innate immune signaling by targeting key components of antiviral pathways:

  • It promotes K48-linked polyubiquitination of STING, leading to its proteasomal degradation

  • This limits the duration and magnitude of STING-dependent immune responses to DNA viruses

  • RNF5 also regulates MAVS stability and function, affecting responses to RNA viruses

  • Some viruses exploit this function to dampen host immune responses

RNF5 as an Antiviral Factor:

Despite its immune-suppressive functions, RNF5 can directly restrict certain viruses:

  • It recognizes and ubiquitinates the E protein of SARS-CoV-2, leading to its degradation via the UPS

  • This RNF5-induced degradation of E inhibits SARS-CoV-2 replication

  • The RNF5 pharmacological activator Analog-1 alleviates disease development in a mouse model of SARS-CoV-2 infection

Complex Virus-Specific Interactions:

The relationship between RNF5 and viruses shows virus-specific complexity:

  • HSV-1 infection increases RNF5 expression in corneal tissues, leading to decreased STING content and enhanced viral replication

  • SARS-CoV-2 employs a dual strategy - while RNF5 degrades its E protein (restrictive), it also mediates K63-linked ubiquitination of the M protein at K15, which promotes viral assembly and release

  • RNF5 recognizes E proteins from various SARS-CoV-2 strains and SARS-CoV, suggesting potential as a broad-spectrum antiviral target

These findings highlight the context-dependent nature of RNF5's role in viral infections and suggest that targeted modulation of RNF5 activity could provide novel antiviral strategies, provided the approach is tailored to the specific virus and infection context.

How do small-molecule modulators of RNF5 function as research tools and potential therapeutics?

The development of small-molecule modulators targeting RNF5 has expanded the toolkit for investigating its functions and opened new therapeutic possibilities. These compounds fall into two main categories: inhibitors/degraders and activators.

RNF5 Inhibitors and Degraders:

FX12, a benzo[b]thiophene derivative, represents a significant advance in RNF5 targeting:

  • It acts as both an inhibitor of RNF5 enzymatic activity and a degrader of the protein itself

  • This dual mechanism offers advantages for research applications, rapidly eliminating RNF5 function

  • Potential applications include cystic fibrosis (enhancing F508del-CFTR rescue) and muscular disorders

The inhibition of RNF5 through small molecules has several downstream effects:

  • Stabilization of substrates including CFTR, STING, and MAVS due to decreased ubiquitination

  • Altered ER stress responses, which can be beneficial in conditions like inclusion body myositis

  • Enhanced antiviral immune responses through stabilization of STING and MAVS

RNF5 Activators:

Analog-1 represents an RNF5 pharmacological activator with antiviral properties:

  • It enhances RNF5's ability to degrade the SARS-CoV-2 E protein

  • This restricts viral replication and alleviates disease in mouse infection models

  • Suggests potential for development of similar compounds against other viral pathogens

Experimental Applications and Considerations:

When using RNF5 modulators in research, several methodological considerations are important:

AspectKey Considerations
Dose-ResponseEstablish clear dose-response curves; determine optimal concentrations; monitor potential off-target effects
Temporal DynamicsAssess both acute and chronic effects; determine time course of action and recovery
Specificity ControlsUse structurally related inactive compounds; compare with genetic knockdown; perform rescue experiments
Combinatorial ApproachesTest with CFTR correctors for CF applications; combine with antivirals for infection models

These small-molecule tools provide valuable approaches for investigating RNF5 biology and developing potential therapeutics for conditions ranging from cystic fibrosis to viral infections and muscular disorders.

What methods can identify and distinguish different ubiquitination patterns mediated by RNF5?

RNF5 can catalyze distinct ubiquitin chain linkages with different functional consequences, particularly K48-linked chains (signaling for degradation) and K63-linked chains (mediating signaling functions). Distinguishing between these patterns is crucial for understanding RNF5's diverse functions.

Advanced Techniques for Analyzing Ubiquitin Chain Topologies:

Several complementary approaches can be used to characterize RNF5-mediated ubiquitination:

  • Ubiquitin Mutants Approach:

    • Using ubiquitin variants with specific lysine-to-arginine mutations (K48R, K63R)

    • These mutants prevent chain formation through the mutated residue

    • Comparative analysis with wild-type ubiquitin reveals predominant linkage types

    • Can be incorporated into both in vitro and cell-based ubiquitination assays

  • Linkage-Specific Antibody Detection:

    • Commercial antibodies specifically recognize K48-linked or K63-linked polyubiquitin

    • Western blotting reveals the presence and abundance of specific linkage types

    • Can be combined with immunoprecipitation to analyze ubiquitination of specific substrates

    • Provides semi-quantitative assessment of different ubiquitin chain types

  • Mass Spectrometry-Based Analysis:

    • Tryptic digestion generates signature peptides for different linkage types

    • Targeted mass spectrometry can identify and quantify specific linkages

    • Provides comprehensive analysis of complex ubiquitination patterns

    • Can identify previously unknown ubiquitination sites on substrates

Examples of RNF5-Mediated Ubiquitination Patterns:

RNF5 exhibits substrate-specific ubiquitination patterns with distinct functional outcomes:

SubstrateUbiquitin LinkageFunctional OutcomeDetection Method
STINGK48-linkedProteasomal degradationIncreased levels with proteasome inhibition
SARS-CoV-2 MK63-linked (K15 site)Enhanced M-E interaction and viral assemblyMutational analysis of K15 site

Experimental Design Considerations:

When analyzing RNF5-mediated ubiquitination, several controls and experimental approaches are essential:

  • Include reactions lacking E1, E2, or ATP as negative controls for specificity

  • Use catalytically inactive RNF5 mutants (RING domain mutants) as controls

  • Include proteasome inhibitors (e.g., MG132) to stabilize K48-linked ubiquitinated proteins

  • Mutate candidate lysine residues on substrates to map specific ubiquitination sites

  • Correlate ubiquitination patterns with functional outcomes (protein stability, interactions)

By employing these approaches, researchers can gain detailed insights into the diverse ubiquitination patterns mediated by RNF5 and their distinct functional consequences across different cellular contexts and disease models.

How does RNF5 contribute to the pathophysiology of inclusion body myositis?

RNF5 has emerged as a significant factor in muscle pathology, particularly in inclusion body myositis (IBM), a progressive muscle disorder characterized by protein aggregation and muscle degeneration. Research using both transgenic mouse models and patient samples has provided valuable insights into RNF5's role in this condition.

Evidence from Experimental Models:

Transgenic mice with manipulated RNF5 expression demonstrate its importance in muscle physiology:

  • Inducible RNF5 overexpression (both ubiquitous and muscle-specific) induces myofiber degeneration associated with altered ER function

  • RNF5 transgenic mice exhibit rapid weight loss and early onset of muscle wasting and kyphosis

  • Conversely, RNF5 knockout mice show delayed repair of muscle damage associated with attenuated ER stress responses

  • This bidirectional effect suggests RNF5 plays a regulatory role in muscle homeostasis and stress response

Clinical Evidence from IBM Patients:

Examination of muscle biopsies from patients with various muscular disorders revealed specific changes in RNF5:

  • Upregulation and mislocalization of RNF5 to protein aggregates in muscles from sporadic IBM (sIBM) patients

  • Similar findings in a mouse model for hereditary IBM

  • These changes appear relatively specific to IBM compared to other muscular disorders such as Duchenne and Becker myopathies

Proposed Pathogenic Mechanisms:

Several mechanisms may explain how RNF5 dysregulation contributes to IBM pathology:

  • ER Stress Dysregulation:

    • RNF5 regulates ER-associated degradation (ERAD) and quality control

    • Overexpression may cause inappropriate degradation of proteins needed for normal ER function

    • This can trigger or exacerbate ER stress, a key feature of IBM

  • Protein Aggregation:

    • RNF5 mislocalization to protein aggregates suggests a role in aggregate formation or processing

    • This may contribute to the characteristic protein inclusions seen in IBM

    • Potential for feed-forward mechanisms where initial aggregation further dysregulates RNF5

  • Altered Ubiquitination Landscape:

    • Excessive or mislocalized RNF5 may disrupt normal protein ubiquitination patterns

    • This could affect multiple cellular pathways beyond the primary RNF5 substrates

    • May interfere with normal protein quality control mechanisms in muscle cells

These findings establish RNF5 as an important factor in muscle physiology and in ER stress-associated muscular disorders, suggesting potential for therapeutic targeting in conditions like IBM. Future research directions include identifying muscle-specific RNF5 substrates and testing whether RNF5 inhibitors like FX12 might have therapeutic value in IBM models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.