Recombinant Rat Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (Enpp5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Enpp5; Ectonucleotide pyrophosphatase/phosphodiesterase family member 5; E-NPP 5; NPP-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-477
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Enpp5
Target Protein Sequence
TEQQKVLVVSFDGFRWDYLYKVPTPHFHYVMKNGVHVKQVTNVFITKTYPNHYTLVTGLF AENHGIVANDMFDPVLNKSFSLEHMNIYDSKFWEEATPLWITNQRAGHASGAAMWPGTDV KIHESYPTHYLPYNESVSFEDRVAKIIEWFTAKDPINLGFLYWEEPDDTGHDVGPDSPLM GPVISDIDHKLGYLIKMLKKAKLWNNINLIVTSDHGMTQCSKERVIELDQYLDKEHYTLI DHSPVAAILPKEGKFNEVYDALANAHPNLTVYKKEEIPERWHYKHSDRVQPIVAVADEGW YILQNKSDEFLLGNHGYDNALAEMHPIFLAHGPAFRKNFTKEAMNSTDLYSLVCHLLNVT ALPHNGSFRNVQDLLSSAAPKAIPYTQSTTLPLGSAKPGEYEQEESYPYYIGISLGSLIA IVFFVVLIKHLIRSQMHTLQYMQVEVAQPLLQA
Uniprot No.

Target Background

Function
This recombinant rat Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (ENPP5) hydrolyzes NAD but not nucleotide di- and triphosphates. It may play a role in neuronal cell communication and lacks nucleotide pyrophosphatase and lysopholipase D activity in vitro.
Gene References Into Functions
  1. ENPP5 is a neural oligomannosidic glycoprotein potentially involved in neural cell communication. PMID: 12927778
Database Links
Protein Families
Nucleotide pyrophosphatase/phosphodiesterase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Brain.

Q&A

What is the molecular weight and structure of rat Enpp5?

Rat Enpp5 shares significant homology with human ENPP-5, which is an approximately 50 kDa protein. The mature human ENPP-5 consists of a 407 amino acid extracellular region containing one phosphodiesterase/nucleotide pyrophosphatase domain, a 21 amino acid transmembrane segment, and a 25 amino acid cytoplasmic tail . Within the ectodomain, human ENPP-5 shares 85% amino acid sequence identity with mouse and rat ENPP-5, suggesting that rat Enpp5 has similar structural characteristics .

What enzymatic activities does rat Enpp5 exhibit?

Rat Enpp5 belongs to the ecto-nucleotide pyrophosphatase/phosphodiesterase (ENPP) family that regulates the availability of extracellular nucleotides. This enzyme family forms a subgroup within a larger family that includes arylsulfatases, phosphopentomutases, phosphoglycerate mutases, and alkaline phosphatases . Based on human ENPP-5 studies, rat Enpp5 likely exhibits phosphodiesterase activity with substrates such as O-(4-Nitrophenylphosphoryl) choline . Additionally, recent studies have identified that some ENPP family members, including ENPP5, may be present in preparations showing 2',3'-cGAMP hydrolase activity .

How does rat Enpp5 compare to other members of the ENPP family?

The ENPP family contains seven members (ENPP1-ENPP7), all functioning as Ca²⁺-metallohydrolases that can hydrolyze ATP and 4-nitrophenyl-dTMP, among other substrates . Rat Enpp5 functions distinctly from other family members. For instance, ENPP1 and ENPP3 account for most of the 2',3'-cGAMP hydrolase activity in mice, while Enpp5 appears to have a more limited role in this particular activity . Each ENPP family member has evolved specialized functions, with Enpp5 being catalytically active in specific tissues and showing altered expression under certain conditions, such as in adipocytes transfected with Agt-shRNA .

What is the optimal assay protocol for measuring rat Enpp5 enzymatic activity?

Based on protocols developed for human ENPP-5, the following assay can be adapted for rat Enpp5:

Materials needed:

  • Assay Buffer: 50 mM Sodium Acetate, 150 mM NaCl, pH 5.5

  • Recombinant rat Enpp5

  • Substrate: O-(4-Nitrophenylphosphoryl) choline (500 mM stock in deionized water)

  • NaOH, 0.2 M in deionized water

  • 96-well Clear Plate

  • Plate Reader

Procedure:

  • Dilute recombinant rat Enpp5 to 5 μg/mL in Assay Buffer

  • Dilute Substrate to 2 mM in Assay Buffer

  • Load 50 μL of 5 μg/mL Enpp5 in a clear plate well

  • Add 50 μL of 2 mM Substrate to start the reaction

  • Include a Substrate Blank (50 μL Assay Buffer + 50 μL 2 mM Substrate)

  • Incubate sealed plate at room temperature for 30 minutes

  • Stop reactions by adding 100 μL of 0.2 M NaOH to each well

  • Read absorbance at 410 nm in endpoint mode

  • Calculate specific activity using the formula :

Specific Activity (pmol/min/μg) =Adjusted Absorbance (OD) × Conversion Factor (pmol/OD)
Incubation time (min) × amount of enzyme (μg)

How should rat Enpp5 be stored and handled to maintain optimal activity?

While specific storage conditions for rat Enpp5 are not directly mentioned in the search results, recommendations can be extrapolated from protocols for similar recombinant proteins. Recombinant Enpp5 should be stored at -80°C for long-term storage and at -20°C for short-term storage. Avoid repeated freeze-thaw cycles as this can compromise enzymatic activity. When working with the protein, keep it on ice or at 4°C. For optimal activity preservation, consider adding stabilizing agents such as glycerol (10-20%) or BSA (0.1-1%) to storage buffers. Prior to activity assays, the protein should be equilibrated to room temperature in the appropriate assay buffer.

How can I generate stable cell lines expressing rat Enpp5?

To generate stable cell lines expressing rat Enpp5, lentiviral vector systems can be used. The search results indicate that rat ENPP5 lentiviral vectors are available with CMV promoters . The general protocol involves:

  • Select an appropriate lentiviral vector (e.g., pLenti-GIII-CMV) containing the rat Enpp5 gene

  • Produce lentiviral particles by transfecting packaging cells (e.g., 293T cells) with:

    • The rat Enpp5 lentiviral vector

    • Packaging plasmids (either 2nd or 3rd generation system)

  • Harvest viral particles from the culture medium

  • Determine viral titer using standard methods

  • Transduce target cells at an appropriate MOI (multiplicity of infection)

  • Select transduced cells using appropriate selection markers (e.g., puromycin if the vector contains a puromycin resistance gene)

  • Verify Enpp5 expression by Western blot, RT-PCR, or functional assays

The MOI should be calculated using the formula: MOI = Virus titer (IU/ml) × Virus Volume (ml) / Total cell number . Different cell types may require different MOIs for successful transduction, so testing a range is recommended.

What mechanisms regulate the time-dependent inactivation of rat Enpp5?

Research indicates that NPP/PDE enzymes from rat liver membranes, which may include Enpp5, undergo time-dependent inactivation by EDTA. This inactivation is enhanced by free amino acids, with the exception of cysteine (which acts as a strong inhibitor) and histidine (which itself causes time-dependent inactivation) .

The mechanism appears to involve conformational changes of the enzyme evoked by interaction with free amino acids. When activity assays are conducted after different incubation periods with EDTA, first-order apparent inactivation constants (ki(ap)) can be calculated. Most free amino acids themselves do not affect enzyme activity directly but increase ki(ap), suggesting they enhance the inactivation effect of EDTA .

For researchers studying rat Enpp5 activity, it's important to consider these inactivation mechanisms, particularly when designing experiments involving metal chelators or in physiological environments where free amino acids are present.

How does rat Enpp5 contribute to co-expression networks in aging-related studies?

Enpp5 has been identified in co-expression network analyses as having catalytic activity whose expression changes in adipocytes transfected with Agt-shRNA . This suggests Enpp5 may play a role in aging-related metabolic processes.

In network construction and module detection analyses, differentially expressed genes (including potentially Enpp5) form interconnected nodes. Genes with higher connections in these networks are more likely to be pivotal connectors or hub genes. The removal of these hub genes may cause biological systems to fail in maintaining their coherence .

To determine if Enpp5 is a critical hub gene in your experimental system, consider:

  • Constructing adjacency matrices from Pearson correlation matrices

  • Identifying highly connected genes in the network

  • Performing module preservation tests to validate the importance of identified modules

  • Conducting functional enrichment analyses to understand the biological pathways associated with Enpp5 and its co-expressed genes

What are the differences in substrate specificity between rat Enpp5 and other ENPP family members?

The ENPP family comprises enzymes with overlapping but distinct substrate specificities. Based on available data, we can infer the following about rat Enpp5 compared to other family members:

  • While ENPP1 was traditionally thought to be the only mammalian enzyme that hydrolyzes 2',3'-cGAMP, recent evidence suggests that ENPP3 also possesses this activity. Mass spectrometry analyses have detected rat Enpp3, Enpp4, and Enpp5 in preparations showing 2',3'-cGAMP hydrolase activity, suggesting Enpp5 might contribute to this function, albeit to a lesser extent than Enpp1 and Enpp3 .

  • Human ENPP-5 exhibits phosphodiesterase activity with the substrate O-(4-Nitrophenylphosphoryl) choline . Given the high sequence homology between human and rat Enpp5 (85% in the ectodomain), rat Enpp5 likely shares similar substrate preferences.

  • Unlike some other ENPP family members that may have broader substrate ranges, Enpp5 appears to have more specialized functions, making it important to test substrate specificity empirically when studying this enzyme.

What are the optimal expression systems for producing recombinant rat Enpp5?

While the search results don't specifically address expression systems for rat Enpp5, general principles for recombinant protein expression can be applied. Based on the information about lentiviral vectors , several expression systems may be suitable:

  • Mammalian Expression Systems:

    • HEK293 or CHO cells are often used for expressing mammalian proteins

    • These systems provide proper post-translational modifications and folding

    • Transfection can be performed using calcium phosphate, lipofection, or electroporation

    • For stable expression, lentiviral vectors with CMV promoters can be used

  • Insect Cell Expression Systems:

    • Baculovirus expression systems in Sf9 or Hi5 cells

    • Suitable for proteins that require eukaryotic processing but not mammalian-specific modifications

  • E. coli Expression Systems:

    • May be challenging for complex eukaryotic proteins like Enpp5

    • Could be attempted for truncated versions lacking transmembrane domains

    • Expression optimization might require specialized strains and chaperone co-expression

For rat Enpp5, mammalian expression systems are likely most appropriate to ensure proper folding and enzymatic activity. The choice of expression vector can significantly impact protein yield and quality.

How can I design optimal primers for cloning rat Enpp5 into expression vectors?

When designing primers for cloning rat Enpp5 into expression vectors, consider the following approach:

  • Obtain the reference sequence:

    • Use the complete rat Enpp5 coding sequence from genetic databases

    • Note that the vector may already contain restriction sites flanking the insert (e.g., NheI and XhoI in some lentiviral vectors)

  • Design gene-specific regions:

    • Forward primer should target the 5' end of the coding sequence

    • Reverse primer should target the 3' end

    • Aim for 18-25 nucleotides of gene-specific sequence with ~50% GC content

  • Add restriction enzyme sites:

    • Include appropriate restriction sites compatible with your destination vector

    • Add 3-6 nucleotides at the 5' end of each primer to ensure efficient restriction enzyme cutting

    • Ensure the insert will be in-frame with any fusion tags in the vector

  • Additional considerations:

    • Check for internal restriction sites within the Enpp5 sequence

    • Verify primer specificity using BLAST

    • Consider codon optimization for your expression system

    • For vectors with reporter genes like GFP, ensure your insert will be in-frame if required

What are the challenges in purifying active rat Enpp5 and how can they be overcome?

Purifying active rat Enpp5 presents several challenges, particularly because it's a membrane-associated protein with an extracellular catalytic domain. Based on the characteristics of ENPP family proteins, the following challenges and solutions can be considered:

Challenges:

  • Membrane association: Enpp5 contains a transmembrane domain that complicates extraction and purification

  • Protein folding: Maintaining proper folding and activity during purification

  • Metal ion dependency: As a Ca²⁺-metallohydrolase, Enpp5 activity depends on proper metal coordination

  • Inactivation: Time-dependent inactivation by metal chelators like EDTA, enhanced by free amino acids

Solutions:

  • Expression strategy:

    • Express truncated version without the transmembrane domain as a secreted protein

    • Add a cleavable signal peptide and purification tag (His, GST, etc.)

  • Extraction conditions:

    • For full-length protein, use mild detergents (CHAPS, DDM, etc.) to solubilize membrane-bound Enpp5

    • Optimize detergent concentration to maintain activity

  • Purification approach:

    • Use affinity chromatography with immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Follow with size exclusion chromatography to remove aggregates and ensure homogeneity

  • Activity preservation:

    • Include calcium or other divalent metal ions in purification buffers

    • Avoid EDTA or use minimally in early purification steps

    • Consider adding stabilizing agents like glycerol or specific substrates

    • Be cautious with buffers containing high concentrations of free amino acids, which may enhance inactivation

  • Quality control:

    • Verify activity using the phosphodiesterase assay with O-(4-Nitrophenylphosphoryl) choline

    • Assess protein homogeneity by SDS-PAGE and size exclusion chromatography

How does rat Enpp5 function in extracellular nucleotide regulation?

Rat Enpp5, like other members of the ENPP family, functions as an ecto-enzyme that regulates the availability of extracellular nucleotides . These enzymes play critical roles in purinergic signaling, which influences numerous physiological processes.

The specific role of Enpp5 in extracellular nucleotide regulation likely involves:

  • Hydrolyzing nucleotide substrates in the extracellular space, potentially including ATP, ADP, and other nucleotide derivatives

  • Modulating purinergic signaling by controlling the availability of specific nucleotides

  • Contributing to the balance of extracellular nucleotides that act as signaling molecules for various cellular processes

The enzymatic activity of Enpp5, showing phosphodiesterase activity with substrates like O-(4-Nitrophenylphosphoryl) choline , suggests it may hydrolyze specific phosphodiester bonds in nucleotide substrates. Given the localization of Enpp5 as a membrane protein with its catalytic domain facing the extracellular space, it is well-positioned to influence the concentrations of extracellular nucleotides and their derivatives.

What is the significance of rat Enpp5 in aging-related research?

Co-expression network analysis has identified Enpp5 as a gene whose expression changes in specific conditions, such as in adipocytes transfected with Agt-shRNA . This suggests potential involvement in metabolic pathways relevant to aging.

In aging-related research, genes with high connectivity in co-expression networks are often considered critical regulators or biomarkers. These "hub genes" represent potential intervention targets due to their central position in gene networks . While specific details about Enpp5's role in aging are not directly addressed in the search results, its identification in co-expression networks warrants further investigation as a potentially important player in age-related biological processes.

To investigate Enpp5's role in aging:

  • Analyze its expression changes across different age groups

  • Identify proteins that interact with Enpp5 in aging tissues

  • Examine how modulation of Enpp5 activity affects aging-related phenotypes

  • Investigate the effects of Enpp5 knockdown or overexpression on senescence markers and aging-related pathways

What is the relationship between rat Enpp5 and transcription factors?

The search results mention a table of transcription factors with normalized enrichment scores and numbers of targets, which may regulate genes including Enpp5 in specific contexts . While direct relationships between these transcription factors and Enpp5 are not explicitly stated, this information provides a starting point for investigating transcriptional regulation of Enpp5.

Transcription factorNESNo. of targetsNo. of Motifs/Tracks
Pax84.484257
Hsf14.04111
Pou5f13.916272
Ovol13.78143
Lef13.589124
Zic23.485172
Rfx23.46463
Egr13.433143
Gata23.422121
Gltpd13.287112
Hic13.224113
Zfat3.212223
Sod13.1441
Irf43.047101
Mtf13.034112

To investigate the relationship between these transcription factors and rat Enpp5:

  • Analyze the Enpp5 promoter region for binding motifs of these transcription factors

  • Perform chromatin immunoprecipitation (ChIP) assays to identify transcription factors that directly bind to the Enpp5 promoter

  • Use reporter gene assays to validate transcription factor binding and functional effects

  • Modulate transcription factor expression and assess effects on Enpp5 expression levels

What are common issues in rat Enpp5 activity assays and how can they be resolved?

Based on the protocols described for ENPP-5 enzymatic assays , several common issues may arise:

Problem: Low or no detectable enzymatic activity

  • Possible causes: Protein denaturation, insufficient enzyme concentration, improper buffer conditions, substrate degradation

  • Solutions:

    • Verify protein quality by SDS-PAGE

    • Increase enzyme concentration in the assay

    • Ensure buffer pH is optimal (try pH 5.5 as used for human ENPP-5)

    • Prepare fresh substrate solution

    • Add divalent metal ions (Ca²⁺, Mg²⁺) if not present in buffer

Problem: High background in colorimetric assays

  • Possible causes: Spontaneous substrate hydrolysis, contaminating phosphatases, improper blanking

  • Solutions:

    • Always include a substrate blank (buffer + substrate without enzyme)

    • Use freshly prepared substrate

    • Include phosphatase inhibitors if appropriate

    • Ensure proper plate reader settings and calibration

Problem: Inconsistent results between replicates

  • Possible causes: Pipetting errors, temperature variations, enzyme instability

  • Solutions:

    • Use calibrated pipettes and consistent technique

    • Control incubation temperature precisely

    • Prepare master mixes to minimize pipetting steps

    • Perform time course experiments to ensure linearity of the reaction

Problem: Time-dependent loss of activity

  • Possible causes: Enzyme inactivation by chelators or amino acids

  • Solutions:

    • Avoid EDTA in buffers when measuring activity

    • Be aware that free amino acids can enhance inactivation by chelators

    • Consider adding stabilizing agents like glycerol

How can I optimize the expression of rat Enpp5 in heterologous systems?

To optimize the expression of rat Enpp5 in heterologous systems:

  • Vector selection:

    • Choose vectors with strong promoters appropriate for your expression system

    • For mammalian expression, CMV promoters work well

    • Consider vectors with appropriate selection markers for stable expression

  • Codon optimization:

    • Adapt the rat Enpp5 coding sequence to the codon usage bias of the host organism

    • Remove rare codons that might cause translational pausing or premature termination

  • Signal peptide and tags:

    • For secreted versions, optimize the signal peptide for your host system

    • Consider using fusion tags that enhance folding and solubility (e.g., SUMO, MBP)

    • Use cleavable tags to allow removal after purification

  • Expression conditions:

    • Optimize temperature (lower temperatures often improve folding of complex proteins)

    • Adjust induction parameters (inducer concentration, timing, duration)

    • For mammalian cells, test different transfection methods (calcium phosphate, lipofection, electroporation)

  • Media and supplements:

    • Use rich media or add supplements that support protein production

    • Consider additives that promote proper folding

    • For mammalian cells, test serum-free versus serum-containing media

  • Scale optimization:

    • Start with small-scale cultures to optimize conditions

    • Validate scalability to larger volumes

    • Monitor cell density and viability during scale-up

What are the best approaches to study Enpp5 gene regulation and expression patterns?

To study Enpp5 gene regulation and expression patterns effectively:

  • Transcriptional profiling:

    • Use RNA-sequencing to measure Enpp5 expression across tissues or experimental conditions

    • Compare expression levels in different developmental stages or disease models

    • Analyze co-expression networks to identify genes with similar expression patterns

  • Promoter analysis:

    • Clone the Enpp5 promoter region into reporter vectors

    • Identify key regulatory elements through deletion and mutation analysis

    • Use lentiviral vectors with promoterless GFP for in vivo promoter studies

  • Transcription factor binding:

    • Analyze Enpp5 promoter for potential transcription factor binding sites

    • Perform ChIP assays to identify factors that bind the promoter in vivo

    • Use EMSAs to confirm direct binding in vitro

    • Consider the transcription factors listed in the search results as potential regulators

  • Epigenetic regulation:

    • Analyze DNA methylation patterns in the Enpp5 promoter region

    • Investigate histone modifications associated with active or repressed Enpp5 expression

    • Study the effects of epigenetic modifiers on Enpp5 expression

  • Functional genomics:

    • Use CRISPR/Cas9 to generate Enpp5 knockout models

    • Create Enpp5 reporter cell lines to monitor expression in real-time

    • Develop conditional expression systems to study temporal aspects of regulation

  • Single-cell analysis:

    • Apply single-cell RNA-seq to understand cell-specific expression patterns

    • Use spatial transcriptomics to map Enpp5 expression in complex tissues

How conserved is Enpp5 across species and what does this suggest about its function?

While specific evolutionary data for Enpp5 is limited in the search results, we know that human ENPP-5 shares 85% amino acid sequence identity with mouse and rat ENPP-5 within the ectodomain . This high level of conservation suggests important functional constraints on the protein structure and function.

The conservation of Enpp5 across mammals indicates that:

  • The enzymatic function of Enpp5 likely plays an essential role that has been maintained through evolutionary history

  • The substrate specificity and catalytic mechanism are probably similar across species

  • Key structural features, including the phosphodiesterase/nucleotide pyrophosphatase domain, are evolutionarily conserved

To further investigate Enpp5 conservation:

  • Perform phylogenetic analysis of Enpp5 sequences from different species

  • Compare critical residues in the catalytic domain across species

  • Examine whether conserved regions correspond to known functional domains or active sites

  • Test whether the enzymatic properties are similar between Enpp5 from different species

What are the functional differences between rat Enpp5 and human ENPP5?

  • Structure and domain organization:

    • Both rat and human proteins likely contain similar domain structures, including the phosphodiesterase/nucleotide pyrophosphatase domain, transmembrane segment, and cytoplasmic tail

    • Minor differences in amino acid sequence may affect protein folding or stability

  • Enzymatic properties:

    • Human ENPP-5 exhibits phosphodiesterase activity with the substrate O-(4-Nitrophenylphosphoryl) choline

    • Rat Enpp5 likely shows similar substrate specificity, but potential differences in kinetic parameters (Km, kcat) have not been directly addressed in the search results

  • Expression patterns:

    • Tissue-specific expression patterns might differ between species

    • Regulatory mechanisms controlling expression could vary

  • Protein interactions:

    • Species-specific protein-protein interactions might lead to functional differences

    • Binding partners may vary between rat and human cellular environments

To experimentally address these differences, researchers could:

  • Compare enzyme kinetics of purified rat and human Enpp5 with various substrates

  • Examine expression patterns in corresponding tissues from both species

  • Perform cross-species complementation studies

  • Identify binding partners through pull-down assays or proximity labeling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.