Recombinant Rat EGF, latrophilin and seven transmembrane domain-containing protein 1 (Eltd1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Adgrl4; Eltd1; Etl; Adhesion G protein-coupled receptor L4; EGF,latrophilin and seven transmembrane domain-containing protein 1; EGF-TM7-latrophilin-related protein; ETL protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
455-738
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
THFAILMSPSTSIEVKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNL CCSLFLAQLVFLVGININTNKLVCSIIAGLLHYFFLAAFAWMCIEGIYLYLIVVGLIYNK GFLHKNFYIFGYLSPAVVVGFSASLGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNL LAFGVIIYKVFRHTAGLKPEVSCYENIRSCARGALALLFLLGTTWTFGVLHVVHASVVTA YLFTVSNAFQGMFIFLFLCVLSRKIQEEYYRLFKNVPCCFECLR
Uniprot No.

Target Background

Function
Endothelial orphan receptor that acts as a key regulator of angiogenesis.
Database Links

KEGG: rno:64124

STRING: 10116.ENSRNOP00000045890

UniGene: Rn.8731

Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Abundantly expressed in heart, lung, and kidney. Less evident expression is observed in brain, skeletal muscle, liver and spleen. No expression is detected in testis.

Q&A

What is ELTD1 and what is its molecular structure?

ELTD1 (epidermal growth factor, latrophilin, and seven transmembrane domain-containing protein 1) is a member of the G-protein coupled receptors (GPCRs) superfamily, specifically belonging to the "adhesion family" of GPCRs . Its structure includes a domain similar to EGF, a short cytoplasmic tail, and a seven-transmembrane domain . ELTD1 is also known as adhesion G protein-coupled receptor L4 (ADGRL4) . The protein was first discovered in developing cardiomyocytes in 2001 and is located on chromosome 1 . The molecular structure features specific large extracellular domains with adhesion elements that distinguish it from other GPCR families .

How is ELTD1 expression regulated in normal tissues?

ELTD1 expression in normal vasculature is regulated by two primary angiogenic pathways. The vascular endothelial growth factor (VEGF) pathway increases ELTD1 expression, while the Delta-like ligand 4 (DLL4)-Notch signaling pathway represses ELTD1 expression . Studies have shown that increased signaling from VEGF-A results in higher ELTD1 expression in endothelial cells . This dual regulatory mechanism suggests ELTD1 serves as an integration point between these two important angiogenic pathways in normal tissue development and maintenance.

How does ELTD1 expression correlate with glioma grade and patient outcomes?

ELTD1 expression has been found to be significantly higher (P = .03) in high-grade gliomas compared to low-grade gliomas . Studies examining 50 patients with high-grade gliomas and 21 patients with low-grade gliomas demonstrated that ELTD1 expression levels were positively associated with cancer progression and poor prognosis in human glioma . Gene expression analysis indicates ELTD1 has an association with tumor grade, survival across grades, and shows increased expression in the mesenchymal subtype of glioblastoma . This correlation makes ELTD1 a potential biomarker for glioma progression and prognosis assessment.

What mechanisms underlie ELTD1's role in glioma progression?

ELTD1 facilitates glioma progression through multiple mechanisms:

  • JAK/STAT3/HIF-1α signaling activation: ELTD1 activates the JAK/STAT3/HIF-1α signaling axis, where p-STAT3 binds with HIF-1α to promote tumor progression .

  • Angiogenesis promotion: As a novel regulator of brain angiogenesis, ELTD1 promotes tumor growth and metastasis .

  • Vascular dysfunction induction: ELTD1 participates in inducing vascular abnormalities in glioma, contributing to the characteristic dysfunctional tumor vasculature .

  • VEGFR2 expression modulation: Targeting ELTD1 has been shown to decrease VEGFR2 expression in glioma models, suggesting a feedback mechanism between these angiogenic factors .

How does ELTD1 influence tumor vasculature and the microenvironment?

ELTD1 plays a critical role in tumor vasculature development and function, as demonstrated through studies with ELTD1-deficient mice:

ParameterWildtype MiceELTD1⁻/⁻ MiceSignificance
Vascular densityBaselineUnchangedNot significant
Vessel perfusionBaselineSignificantly increasedImproved functionality
Fibrinogen leakageHighReducedImproved blood-brain barrier
Tumor hypoxiaHighReducedBetter oxygenation
Lef1+ vesselsBaselineIncreasedEnhanced Wnt signaling

ELTD1 deletion reduces vascular abnormalities without affecting vascular density or pericyte coverage . Transcriptome analysis of tumor endothelial cells from ELTD1⁻/⁻ mice revealed downregulation of Myc and E2F pathways, suggesting a more quiescent tumor endothelium . Additionally, ELTD1 deletion enhances immune response pathways, with enrichment of genes associated with inflammatory response and interferon alpha and gamma responses .

What methods are most effective for detecting ELTD1 in experimental settings?

Several validated methods have been employed to detect and measure ELTD1 expression:

  • Immunohistochemistry (IHC): Effective for detecting ELTD1 in tissue samples from human high-grade gliomas and rat glioma tumors . IHC allows researchers to compare ELTD1 levels with traditional markers including VEGF, glucose transporter 1, carbonic anhydrase IX, and HIF-1α .

  • Molecular Magnetic Resonance Imaging: Successfully used to assess in vivo levels of ELTD1 in rat F98 gliomas compared to normal brain tissue .

  • RNA-sequencing: Valuable for analyzing ELTD1 expression patterns and associated gene networks . This technique has been used to identify 168 differentially expressed genes in ELTD1⁻/⁻ tumor endothelial cells compared to wildtype .

  • Quantitative RT-PCR and Western blotting: Essential methods for measuring ELTD1 expression levels in cell lines and tissue samples .

What are appropriate animal models for studying ELTD1 in gliomas?

Several validated animal models have been employed in ELTD1 research:

  • Orthotopic G55 xenograft model: Human G55 glioblastoma cells implanted into the brains of immunocompromised mice, allowing assessment of human tumor cell behavior in vivo .

  • GL261 mouse glioma model: Murine glioma cells implanted into wildtype or ELTD1⁻/⁻ mice, enabling the study of ELTD1's role in tumor progression and microenvironment .

  • CT-2A mouse model: Another murine glioma model used to validate findings in ELTD1⁻/⁻ mice, showing reduced fibrinogen leakage and increased proportion of Lef1+ vessels .

  • F98 rat glioma model: Used for detection of in vivo levels of ELTD1 through molecular magnetic resonance imaging .

These models offer complementary advantages for studying different aspects of ELTD1 biology in gliomas, from basic molecular mechanisms to potential therapeutic approaches.

How does ELTD1 interact with the Notch signaling pathway?

ELTD1 has a complex relationship with Notch signaling pathways:

  • Notch regulation of ELTD1: DLL4-Notch signaling decreases ELTD1 expression in normal vasculature, establishing an inhibitory relationship .

  • ELTD1 influence on Notch1: Anti-ELTD1 treatment affects Notch1 positivity staining, and RNA-sequencing results suggest that ELTD1 can interact with and interrupt Notch1 signaling . This potentially bidirectional relationship indicates ELTD1 may modulate Notch pathway activity in tumor contexts.

  • Wnt/Notch pathway interaction: In ELTD1⁻/⁻ mice, an increase in Lef1-positive vessels was observed, suggesting that ELTD1 deletion enhances Wnt signaling . The Wnt signaling pathway is important for maintaining vascular barrier function in the brain and is upregulated during blood-brain barrier establishment, indicating potential cross-talk between ELTD1, Notch, and Wnt signaling networks.

What gene expression changes occur with ELTD1 deletion in tumors?

RNA sequencing analysis of tumor endothelial cells from ELTD1⁻/⁻ mice compared to wildtype revealed significant transcriptional changes:

Pathway/Gene CategoryRegulation in ELTD1⁻/⁻Functional Implication
Myc and E2F pathwaysDownregulatedMore quiescent tumor endothelium
Inflammatory response pathwaysUpregulatedEnhanced immune response
Interferon alpha/gamma responsesUpregulatedEnhanced immune response
MHC class I molecules (H2-D1, H2-Ab1)UpregulatedImproved antigen presentation
CXCL12UpregulatedEnhanced lymphocyte chemotaxis
EDN1 and ICAM1UpregulatedIncreased vascular inflammation

A total of 168 genes were differentially expressed in ELTD1⁻/⁻ tumor endothelial cells compared to wildtype . GO term enrichment analysis revealed an enrichment of genes associated with antigen processing and presentation, suggesting that T-cell responses may be enhanced in gliomas in ELTD1⁻/⁻ mice . This transcriptional reprogramming indicates ELTD1 may suppress anti-tumor immune responses in the tumor microenvironment.

How effective are monoclonal antibodies against ELTD1 for glioma treatment?

Monoclonal antibody (mAb) treatment against ELTD1 has shown promising results in pre-clinical glioma models:

  • Increased survival: Monoclonal anti-ELTD1 treatment significantly increased animal survival compared to both control and polyclonal antibody-treated mice .

  • Reduced tumor volumes: Treatment with mAb against ELTD1 resulted in smaller tumor volumes compared to controls .

  • Vascular normalization: Anti-ELTD1 mAb normalized tumor vasculature, potentially improving delivery of other therapeutic agents .

  • Improved specificity: Optimized monoclonal anti-ELTD1 antibodies demonstrate higher binding specificity within tumors compared to polyclonal antibodies, targeting only the external region of the receptor . This improved specificity overcomes concerns about batch-to-batch variabilities and potential promiscuity of polyclonal antibodies that limit their potential as long-term treatments .

How does ELTD1 targeting compare to other anti-angiogenic approaches?

ELTD1-targeted therapies may offer several advantages over conventional anti-angiogenic approaches:

  • Dual targeting: ELTD1 is expressed on both endothelial and tumor cells, potentially allowing simultaneous targeting of both compartments .

  • Vascular normalization: Unlike some VEGF inhibitors that may cause vascular pruning, ELTD1 targeting appears to normalize vasculature without reducing vessel density, potentially improving delivery of other therapeutics .

  • Immune enhancement: ELTD1 deletion enhances immune-related gene expression, suggesting ELTD1 targeting might complement immunotherapy approaches .

  • Overcoming resistance: Clinical application of therapies involving VEGF and NOTCH signaling pathways has shown limited success, possibly due to tumor resistance . As ELTD1 integrates signals from both pathways, targeting it might overcome resistance mechanisms.

How might ELTD1 targeting affect the immune microenvironment in gliomas?

ELTD1 deletion or inhibition appears to enhance immune responses within the tumor microenvironment through several mechanisms:

  • Enhanced antigen presentation: Upregulation of MHC class I molecules (H2-D1 and H2-Ab1) responsible for displaying antigens to T cells .

  • Improved T-cell infiltration: Increased expression of CXCL12, which is chemotactic for lymphocytes, potentially enhancing T-cell recruitment into tumors .

  • Vascular inflammation: Increased expression of endothelin 1 (EDN1) and ICAM1 in tumor vessels, which may facilitate immune cell adhesion and extravasation .

  • Interferon response enhancement: Enrichment of pathways associated with interferon alpha and gamma responses, which are critical for anti-tumor immunity .

These findings suggest that targeting ELTD1 may not only inhibit tumor angiogenesis but also reprogram the tumor microenvironment to be more favorable for anti-tumor immune responses, potentially enhancing the efficacy of immunotherapies.

What are the critical knowledge gaps in ELTD1 biology that need addressing?

Despite recent advances, several important aspects of ELTD1 biology remain unclear:

  • Ligand identification: The natural ligand(s) for ELTD1 have not been definitively identified, limiting our understanding of its activation mechanisms .

  • Downstream signaling pathways: While some pathways have been implicated (JAK/STAT3/HIF-1α), the complete signaling network downstream of ELTD1 remains to be elucidated .

  • Potential off-target effects: As ELTD1 is expressed in cardiomyocytes and has roles in normal physiology, potential side effects of systemic ELTD1 inhibition need investigation .

  • Cancer type specificity: While ELTD1's role has been studied in gliomas and some other cancers, its relevance across diverse cancer types requires further investigation .

What methodological advances would accelerate ELTD1 research?

Several technological and methodological advances could significantly enhance ELTD1 research:

  • Structural biology approaches: Crystal or cryo-EM structures of ELTD1 would facilitate rational drug design and understanding of activation mechanisms.

  • Single-cell technologies: Applying single-cell RNA-seq and spatial transcriptomics to examine ELTD1 expression patterns and effects at cellular resolution within heterogeneous tumors.

  • Humanized models: Development of humanized mouse models with patient-derived xenografts to better translate pre-clinical findings to human disease.

  • Combinatorial therapeutic approaches: Testing ELTD1-targeted therapies in combination with immunotherapies, chemotherapies, and other targeted agents to identify synergistic treatment strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.