Recombinant Rat Emerin (Emd)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Emerin (Emd)

Emerin, a protein encoded by the EMD gene (also known as the STA gene in humans), is a well-conserved component of the inner nuclear membrane found in vertebrates . It is a member of the nuclear lamina-associated protein family . Recombinant Rat Emerin (Emd) refers to the recombinant form of this protein specifically derived from rats. Emerin is crucial for various cellular functions, including gene expression regulation, cell signaling, maintaining nuclear structure, and chromatin architecture .

Structure and Properties

Emerin is a serine-rich protein with a molecular weight of approximately 29.0 kDa (although it can be observed at 34 kDa) . The protein consists of 254 amino acids and features a hydrophobic region near the N-terminus, which is critical for anchoring it to the nuclear membrane . The charged terminal tails are cytosolic .

Table 2: Key Research Findings on Emerin

FindingDescription
Tyrosine PhosphorylationEmerin is phosphorylated by tyrosine kinases (e.g., Src, Abl), indicating its role in signal transduction at the nuclear envelope .
Phosphorylation SitesResidues Y59, Y74, and Y95 are major sites of Src phosphorylation. Mutation of these sites reduces tyrosine phosphorylation in vitro and in vivo .
Mitochondrial RoleLoss of emerin impairs mitochondrial oxidative phosphorylation, alters mitochondrial networks, and downregulates factors involved in mitochondrial biogenesis, fission, and fusion .
Association with Lmo7Interaction with Lmo7 is important for skeletal muscle structure and function. Lmo7-null mice exhibit growth retardation, smaller skeletal muscle fibers, and decreased cardiac function, similar to phenotypes observed in EDMD models .

Clinical Significance

Mutations in the EMD gene, which encodes emerin, are known to cause Emery-Dreifuss muscular dystrophy (EDMD) . This condition is characterized by:

  • Early contractures of the Achilles tendons, elbows, and post-cervical muscles

  • Muscle weakness, primarily in the upper limbs proximally and lower limbs distally

  • Cardiac conduction defects, ranging from sinus bradycardia to complete heart block

  • Impact on Mitochondrial Function: Cardiac disorders caused by EMD mutations may be mitigated by targeting mitochondrial bioenergetics .

Table 3: Clinical Significance of Emerin

AspectDescription
Disease AssociationMutations in the EMD gene cause Emery-Dreifuss muscular dystrophy (EDMD) .
SymptomsContractures, muscle weakness, cardiac conduction defects
Molecular MechanismLoss of functional emerin disrupts nuclear membrane integrity and affects gene regulation, cell signaling, and mechanotransduction .
Potential Therapeutic TargetTargeting mitochondrial bioenergetics may alleviate cardiac disorders caused by EMD mutations .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life is influenced by storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Emd; Emerin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Emd
Target Protein Sequence
MDDYAVLSDTELAAVLRQYNIPHGPILGSTRKLYEKKIFEYETQRRRLSPPSSSSSSFSY RFSDLDSASVDSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTRTYGEPESVGMSKSFRR PGTSLVDADDTFHHQVRDDIFSSSEEEGKDRERPIYGRDSAYQSIAEYRPISNVSRSSLG LSYYPRSSTSSVSSSSSSPSSWLTRRAIRPEKQAPTAALGQDRQVPLWGQLLLFLAFATF LLFVYYSIQAQEGNPFWMDP
Uniprot No.

Target Background

Function
Recombinant Rat Emerin stabilizes and promotes the formation of a nuclear actin cortical network. It stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Further, it inhibits β-catenin activity by preventing its nuclear accumulation, influencing nuclear β-catenin accumulation via a CRM1-dependent export pathway. Emerin also links centrosomes to the nuclear envelope through microtubule association and is required for the proper localization of non-farnesylated prelamin-A/C.
Gene References Into Functions
  1. Emerin plays a crucial role in nuclear invagination and nuclear calcium transients in Emery-Dreifuss muscular dystrophy. PMID: 28290476
  2. Research indicates a pathogenic role for emerin and lamin A/C repression in stretch-induced vascular smooth muscle cell proliferation, suggesting a mechanobiological mechanism involving sequence-specific binding of emerin and lamin A/C to specific transcription factor motifs. PMID: 27114541
  3. Studies demonstrate that epitope masking within the nucleus frequently hinders the detection of emerin and lamins in human, rat, and pig tissues. PMID: 16283426
Database Links
Subcellular Location
Nucleus inner membrane; Single-pass membrane protein; Nucleoplasmic side. Nucleus outer membrane.

Q&A

What are the key structural domains of Rat Emerin and their functional significance?

Rat Emerin contains several crucial domains:

DomainResiduesFunction
LEM domain1-47Mediates binding to BAF (Barrier-to-Autointegration Factor) and chromatin
"SAYQ" region~147-174Contains the sequence P153MYGRDSAYQSITHYRP169, involved in emerin-emerin interactions
AR region170-220Contains elements mediating emerin self-association
R element~187-220Contains a positive element essential for intermolecular association
Transmembrane domain~220-246Anchors emerin to the nuclear membrane

The LEM domain is particularly significant as it provides direct interaction with BAF, while the AR region mediates emerin-emerin associations, which are critical for nuclear envelope structure .

How does Rat Emerin integrate into cellular membranes and what pathways are involved?

Rat Emerin, like human emerin, is a tail-anchored protein primarily found at the inner nuclear membrane (INM). Integration involves the TRC40/GET pathway for post-translational insertion into membranes. This process requires:

  • ATP-dependent targeting

  • Recognition by TRC40

  • Membrane insertion via the TRC40-receptor proteins WRB and CAML

Proximity ligation assays demonstrate that emerin interacts with TRC40 in situ. Experiments show that emerin expressed in bacteria or cell-free lysates can be inserted into microsomal membranes in an ATP- and TRC40-dependent manner . Disruption of this pathway affects the proper localization of emerin to the INM, which may contribute to the pathology observed in EDMD .

What expression systems yield functional recombinant Rat Emerin with highest efficiency?

E. coli expression systems have been successfully used to produce recombinant Rat Emerin. The commercially available recombinant full-length Rat Emerin is produced in E. coli with an N-terminal His tag . When expressing Rat Emerin:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, simpler purificationMay lack post-translational modifications
Insect cellsBetter folding for complex proteinsMore complex, lower yield
Mammalian cellsNative-like modificationsHighest complexity, lower yield

For structural studies or binding assays where post-translational modifications are less critical, E. coli expression offers the best balance of yield and functionality .

What purification strategy produces the highest quality Recombinant Rat Emerin for interaction studies?

A multi-step purification approach is recommended:

  • Initial capture using affinity chromatography (His-tag based IMAC)

  • Buffer exchange to remove imidazole

  • Secondary purification via ion exchange chromatography

  • Size exclusion chromatography to remove aggregates

Key buffer considerations include:

  • Maintain pH 8.0 for optimal stability

  • Include 6% trehalose to prevent aggregation during storage

  • Consider Tris/PBS-based buffers for compatibility with downstream applications

After purification, protein quality should be verified by SDS-PAGE (>90% purity) and functional binding assays with known interaction partners such as BAF or lamins .

What are the optimal storage conditions for maintaining Recombinant Rat Emerin stability and activity?

Optimal storage conditions for Recombinant Rat Emerin include:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution in deionized sterile water (0.1-1.0 mg/mL), add glycerol to a final concentration of 50%

  • Aliquot to avoid repeated freeze-thaw cycles

  • For short-term storage (up to one week), working aliquots can be kept at 4°C

For reconstitution buffer, use:

  • Tris/PBS-based buffer, pH 8.0

  • 6% Trehalose to enhance stability

Repeated freeze-thaw cycles significantly impact protein integrity and should be avoided. Stability tests show that properly stored protein maintains activity for structural and interaction studies for at least 6 months.

How can researchers effectively study Emerin-Emerin interactions using recombinant protein?

Several complementary approaches are recommended:

  • Peptide array analysis: Use GST-tagged emerin fragments (e.g., GST-emerin-170-220) to probe arrayed 20-mer emerin peptides spotted on cellulose membranes. This approach identified key interaction regions including the R-peptide (human residues 206-225) and SAYQ-region peptides .

  • Co-immunoprecipitation assays: Express differentially tagged emerin constructs (e.g., GFP-emerin and Flag-emerin) in cell lines like HEK293T, followed by immunoprecipitation with anti-Flag antibodies and detection with anti-GFP antibodies. This approach confirmed intermolecular emerin-emerin association and identified regions critical for this interaction .

  • In vitro binding assays: Purify recombinant emerin fragments and perform direct binding assays using techniques such as surface plasmon resonance or pull-down assays.

Data from such experiments revealed two modes of emerin-emerin association: one mediated by association between residues 170-220 in different molecules, and another involving residues 170-220 and 1-132 .

What methods can be used to study the interaction between Rat Emerin and nuclear lamins?

The following methodological approaches are effective:

  • Direct binding assays: Recombinant emerin fragments (residues 1-132 and 159-220) have each been shown sufficient to bind lamin A or B1 tails in vitro, identifying two independent regions of molecular contact with lamins .

  • Co-immunoprecipitation: From cellular extracts of undifferentiated C2C12 myoblasts or purified hepatocyte nuclei, using emerin antibodies to pull down associated proteins. This technique demonstrated that both A- and B-type lamins interact with emerin .

  • Proximity ligation assays: This technique can detect protein-protein interactions in situ with high sensitivity and specificity, as demonstrated with emerin and TRC40 .

  • Immunofluorescence co-localization: In C. elegans, Ce-MAN1 (another LEM domain protein) was shown to interact directly with Ce-lamin and Ce-BAF in vitro and required Ce-lamin for its nuclear envelope localization, suggesting similar dependencies for emerin .

These techniques have revealed that emerin contains multiple regions capable of interacting with lamins, which is critical for its proper localization and function.

How can researchers effectively model EDMD mutations using Recombinant Rat Emerin?

To model EDMD mutations using Recombinant Rat Emerin:

  • Site-directed mutagenesis: Introduce specific mutations corresponding to those found in EDMD patients, such as deletions in the transmembrane region (Del236-241) or mutations in the N-terminal domain .

  • Expression and localization studies: Transfect GFP-emerin constructs reflecting these mutations into cell lines (e.g., undifferentiated C2C12 myoblasts) to assess localization. Studies show that while both wild-type and mutant emerins are targeted to the nuclear membrane, mutants show reduced localization efficiency .

  • Functional assays: Assess the impact of mutations on:

    • Emerin-emerin interactions

    • Binding to lamins and BAF

    • Nuclear envelope stability

  • Rapamycin-based dimerization assay: This technique can reveal correct transport of wild-type emerin to the INM, whereas TRC40-binding, membrane integration, and INM-targeting of emerin mutant proteins may be disturbed .

Research has shown that mutations affecting the transmembrane region have more severe effects on nuclear envelope targeting compared to mutations in the N-terminal domain .

How does Rat Emerin function in mitochondrial regulation and what experimental approaches can assess this?

Recent research has uncovered a previously unknown role for emerin in mitochondrial regulation:

  • Mitochondrial oxidative phosphorylation: Knockdown of emerin in HL-1 or H9C2 cardiomyocytes leads to impaired mitochondrial oxidative phosphorylation capacity with:

    • Downregulation of electron transport chain complexes I and IV

    • Upregulation of complexes III and V

  • Mitochondrial dynamics: Loss of emerin in HL-1 cells results in:

    • Collapsed mitochondrial membrane potential

    • Altered mitochondrial networks

    • Downregulation of factors involved in mitochondrial biogenesis, fission, and fusion (PGC1α, DRP1, MFF, MFN2)

Experimental approaches to assess this function include:

  • RNA interference to knockdown emerin expression

  • Measurement of mitochondrial membrane potential

  • Analysis of mitochondrial network morphology

  • Quantification of electron transport chain complex expression

  • Assessment of factors regulating mitochondrial dynamics

This connection to mitochondrial function provides a novel perspective on the pathophysiology of EDMD and suggests targeting mitochondrial bioenergetics might be an effective strategy against cardiac disorders caused by EMD mutations .

What are the emerging techniques for studying the role of emerin in chromatin organization?

Advanced techniques for studying emerin's role in chromatin organization include:

  • Chromosome conformation capture techniques (Hi-C, 4C-seq): These methods can map the three-dimensional organization of chromatin and assess how emerin depletion or mutation affects genome organization.

  • ChIP-seq analysis: To identify genomic regions that interact with emerin, directly or indirectly through its binding partners.

  • Live-cell imaging: Using fluorescently tagged emerin and chromatin markers to visualize dynamic interactions during cell cycle progression.

  • BAF-emerin interaction studies: The LEM domain of emerin mediates direct binding to BAF, a chromatin-associated protein. Studies have shown that this interaction is critical for proper chromatin organization and nuclear assembly .

  • Phenotypic analysis in model systems: In C. elegans, loss of both Ce-emerin and Ce-MAN1 (90% reduction) results in embryonic lethality with a phenotype involving repeated cycles of anaphase chromosome bridging and cytokinesis ("cell untimely torn" phenotype) .

These approaches can help elucidate how emerin contributes to nuclear architecture and genome organization, which is disrupted in EDMD.

What approaches can resolve contradictory findings about emerin localization outside the nuclear envelope?

Studies have reported seemingly contradictory findings about emerin localization outside the nuclear envelope. To resolve these contradictions:

  • Multiple antibody validation: Use different well-characterized antibodies against distinct epitopes. Studies screening 15 monoclonal emerin antibodies by immunofluorescence showed varying results: two were clearly positive for intercalated disc (ICD) localization, five were faintly positive, while others showed no staining .

  • Complementary detection methods: Combine techniques such as:

    • Indirect immunofluorescence

    • Immuno-gold EM labeling

    • Biochemical fractionation

    • Proximity ligation assays

  • Tissue-specific analysis: Emerin has been detected at the plasma membrane in rat cardiomyocytes and in heart tissue from human, rat, and mouse, specifically at adhesive junctions of intercalated discs (ICDs) .

  • Control for epitope masking: Lack of staining may be inconclusive since specific epitopes might be masked by location-specific partners or post-translational modifications .

  • Expression of tagged emerin: Use fluorescently tagged emerin to track localization in live cells, complemented by fixation and immunostaining.

These methodological approaches can help reconcile findings suggesting emerin may have distinct localizations in different cell types or physiological states.

What are the common challenges in expressing soluble Recombinant Rat Emerin and how can they be addressed?

Common challenges and solutions include:

ChallengeSolution Approach
Protein aggregation- Add 6% trehalose to storage buffer
- Maintain pH at 8.0
- Include mild detergents for transmembrane region
- Express truncated forms lacking the transmembrane domain for solubility
Low expression yield- Optimize codon usage for E. coli
- Test different expression temperatures (16-30°C)
- Use specialized E. coli strains (BL21-CodonPlus, Rosetta)
- Try alternative fusion tags (MBP for enhanced solubility)
Improper folding- Co-express with molecular chaperones
- Perform on-column refolding during purification
- Slow dialysis to remove denaturants
Proteolytic degradation- Add protease inhibitors during purification
- Reduce expression time
- Express as separate domains if full-length is unstable

For membrane-spanning regions, specialized approaches such as expressing emerin without its transmembrane domain or using mild detergents like DDM or CHAPS may be necessary to maintain solubility while preserving function .

How can researchers validate the functionality of purified Recombinant Rat Emerin?

Functionality validation requires multiple complementary approaches:

  • Binding assays with known partners:

    • BAF binding assay using purified recombinant BAF

    • Lamin binding assay with lamin A/C and B1 tails

    • Self-association assays to confirm emerin-emerin interactions

  • Structural integrity assessment:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to confirm proper folding

    • Thermal shift assays to determine stability

  • Functional reconstitution:

    • Membrane integration assays using microsomes

    • ATP- and TRC40-dependent membrane insertion assays

  • Activity in cellular context:

    • Transfection into emerin-null cells to rescue phenotypes

    • Assessment of nuclear envelope reformation after mitosis

    • Restoration of proper chromatin organization

These validation steps ensure that the recombinant protein retains both structural integrity and functional activity comparable to native emerin.

How might emerging structural biology techniques advance our understanding of Rat Emerin function?

Emerging structural biology techniques offer promising avenues for emerin research:

  • Cryo-electron microscopy (Cryo-EM): Could resolve the structure of emerin within the context of nuclear envelope complexes, particularly challenging given emerin's predicted intrinsic disorder .

  • Integrative structural biology: Combining X-ray crystallography of ordered domains with NMR spectroscopy of flexible regions to build comprehensive structural models.

  • Single-molecule FRET: To investigate the dynamics of emerin conformational changes during interactions with binding partners like BAF and lamins.

  • In-cell NMR: Could provide insights into emerin structure and dynamics in the native cellular environment.

  • AlphaFold and other AI-based prediction methods: To model the tertiary structure of emerin and predict interaction interfaces with binding partners.

These approaches would help overcome current limitations in understanding emerin's molecular mechanism, particularly given evidence of multiple "backbone" and LEM-domain configurations in the proposed intermolecular emerin network at the nuclear envelope .

What is the significance of LEM domain protein functional overlap and how can it be studied experimentally?

Studies in C. elegans have revealed crucial functional overlap between LEM domain proteins:

  • Significance:

    • While loss of Ce-emerin alone has no detectable phenotype in C. elegans, partial reduction (90%) of Ce-MAN1 in emerin-null cells is lethal to all embryos by the 100-cell stage

    • This "enhanced lethality" demonstrates that LEM domain proteins are essential for cell division

    • Emerin has at least one significant function that overlaps with MAN1, preventing death of MAN1-reduced cells

  • Experimental approaches:

    • Combined RNAi/genetic knockouts: Study phenotypes when multiple LEM proteins are simultaneously reduced/eliminated

    • Rescue experiments: Test whether overexpression of one LEM protein can rescue defects caused by loss of another

    • Domain swapping: Create chimeric proteins to identify which domains confer redundant functions

    • Immunostaining analysis: In C. elegans, anaphase-bridged chromatin retained mitosis-specific phosphohistone H3 epitopes and failed to recruit detectable Ce-lamin or Ce-BAF

    • Proteomic analysis: Identify common binding partners between different LEM proteins

  • Relevance to EDMD:

    • Understanding functional overlap might explain tissue-specific pathology in EDMD despite emerin's ubiquitous expression

    • Could reveal compensatory mechanisms that might be therapeutically enhanced

    • May provide insight into why mutations in different proteins (emerin and lamins) can cause similar disease phenotypes

This research direction is particularly relevant for understanding the complex pathophysiology of EDMD and developing potential therapeutic approaches.

How do the biochemical properties of Recombinant Rat Emerin compare to human emerin for modeling EDMD mutations?

Comparative analysis between rat and human emerin:

PropertyRat EmerinHuman EmerinRelevance to EDMD Research
Sequence conservation260 amino acids254 amino acidsHigh homology in functional domains allows rat emerin to model human disease mutations
LEM domainHighly conservedHighly conservedMutations affecting BAF binding can be effectively modeled in rat emerin
Lamin binding regionsTwo independent regions (1-132 and 159-220)Two independent regionsLamin interaction studies with rat emerin provide insights into EDMD mechanisms
Transmembrane domainC-terminal (similar position)C-terminalMutations affecting membrane integration can be studied in both species
Post-translational modificationsLess characterizedBetter characterizedHuman-specific modifications may need to be introduced for certain studies

What insights have been gained from comparative studies of emerin across species for evolutionary conservation of function?

Comparative studies have revealed:

  • Conserved functional domains across species:

    • Manual alignment of human, rat, nine-banded armadillo, and zebrafish emerin sequences shows conservation of key functional regions

    • The R-peptide region and portions of the SAYQ-region show qualitatively stronger conservation, suggesting functional importance

  • Evolutionary significance of LEM domain proteins:

    • Only three LEM proteins are conserved in C. elegans: Ce-MAN1, Ce-emerin, and lem-3

    • This reduced complexity in C. elegans has facilitated study of LEM protein functions and interactions in vivo

  • Functional conservation despite sequence divergence:

    • Despite sequence variations, emerin's interactions with BAF and lamins are conserved across species

    • The functional redundancy between emerin and MAN1 is also conserved, suggesting evolutionary pressure to maintain nuclear envelope integrity

  • Species-specific variations in emerin localization:

    • In rat cardiomyocytes, emerin was detected at intercalated discs and the nuclear envelope

    • These differential localizations may reflect species-specific adaptations in certain tissues

These comparative studies provide context for understanding the essential and conserved functions of emerin versus those that may have evolved for species-specific requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.