Recombinant Rat Endomucin (Emcn)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Emcn; Endomucin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-250
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Emcn
Target Protein Sequence
ENSKALTETSTTKASATTPDMVSITNKSTGGTPPKGTTNSATPKTPLMPALDSPTTPKHE TTTRGVIKNEVSTIKTTVANPTISNAVSTLSSPQNKTENQSSIRTTEISGTNQLPDDQKP KTTETPSASLTTAKTISQIQDTEDGKITATTSTTPSYSSVILPVVIALIVITVLVFTLVG LYRICWKRDPGTPESGNDQPQSDKESVKLLTVKTISHESGEHSAQGKAKN
Uniprot No.

Target Background

Function
Endothelial sialomucin (endomucin or mucin-like sialoglycoprotein) interferes with focal adhesion complex assembly and inhibits cell-extracellular matrix interactions.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Rat Endomucin and what are its primary physiological functions?

Endomucin (EMCN) is an endothelial sialomucin or mucin-like sialoglycoprotein that plays critical roles in vascular biology. In rat tissues, Endomucin primarily functions by interfering with the assembly of focal adhesion complexes and inhibiting interactions between cells and the extracellular matrix . This property makes Endomucin essential for maintaining vascular integrity and regulating cell adhesion processes in rat vasculature. The protein is typically expressed on the luminal surface of endothelial cells where it contributes to the anti-adhesive property of the endothelial surface, preventing inappropriate cell adhesion during physiological blood flow. At the molecular level, rat Endomucin contains highly O-glycosylated extracellular domains that contribute to its anti-adhesive properties and vascular compartment maintenance. Additional functions include participation in leukocyte trafficking and potentially regulating angiogenesis in specific tissue contexts.

How does Rat Endomucin differ structurally and functionally from human and mouse orthologs?

Rat Endomucin (UniProt ID: Q6AY82) shares significant sequence homology with its human (Q9ULC0) and mouse (Q9R0H2) orthologs, but certain structural and functional differences exist . The rat variant has species-specific glycosylation patterns that may affect its binding properties and molecular interactions within the vascular microenvironment. While all three orthologs interfere with focal adhesion assembly, the rat variant may exhibit tissue-specific expression patterns that differ from human and mouse counterparts. When comparing molecular weights, rat Endomucin typically runs at approximately 75-85 kDa on Western blots under reducing conditions, similar to mouse Endomucin, though slight differences in migration patterns can be observed due to species-specific post-translational modifications . These differences become particularly important when selecting appropriate antibodies for cross-species studies and may necessitate optimization of experimental protocols when transitioning between model systems.

What are the recommended methods for detecting endogenous Rat Endomucin expression in different tissue types?

For detecting endogenous Rat Endomucin expression, multiple validated methodological approaches are available. Western blotting using polyclonal or monoclonal antibodies specific to rat Endomucin can reliably detect the protein (75-85 kDa) in tissue lysates such as kidney, lung, and vascular-rich tissues . For immunohistochemical detection in paraffin-embedded rat tissues, antibody concentrations of 1:1000 dilution are typically effective, following standard antigen retrieval procedures using citrate buffer (pH 6.0) . Flow cytometry is highly effective for quantifying Endomucin expression in isolated rat endothelial cells, requiring approximately 1×10^6 cells and using conjugated secondary antibodies for detection . Immunofluorescence microscopy can visualize the subcellular localization of Endomucin, which typically shows membrane and cytoplasmic staining patterns in endothelial cells, using concentrations of approximately 10 μg/mL of primary antibody followed by fluorophore-conjugated secondary antibodies . When comparing expression across different rat tissues, kidney, lung, and highly vascularized tissues generally show the strongest endogenous expression levels.

What are the optimal expression systems for producing functional Recombinant Rat Endomucin?

The production of functional Recombinant Rat Endomucin requires careful selection of expression systems to ensure proper post-translational modifications, particularly glycosylation. Mammalian expression systems, particularly Chinese Hamster Ovary (CHO) cells or Human Embryonic Kidney (HEK293) cells, are strongly preferred over bacterial systems due to their ability to perform complex O-glycosylations that are crucial for Endomucin's function . When using these systems, the inclusion of the rat Endomucin signal peptide sequence in expression constructs ensures proper trafficking to the cell membrane. Expression yields can be optimized by using strong promoters like CMV or EF1α, and typical expression protocols involve transfection followed by 48-72 hours of expression before protein harvest. For proper folding and function, expression at lower temperatures (30-32°C) during the production phase can improve the proportion of correctly folded protein. Purification typically employs affinity chromatography using tags such as His6 or FLAG, followed by size exclusion chromatography to ensure homogeneity of the final product.

What are the critical parameters for successful Western blot detection of Recombinant Rat Endomucin?

Successful Western blot detection of Recombinant Rat Endomucin requires attention to several critical parameters. Sample preparation should include reducing conditions with DTT or β-mercaptoethanol to fully denature the protein, as Endomucin contains disulfide bonds that affect its migration pattern . Optimal SDS-PAGE separation is achieved using 8-10% polyacrylamide gels due to Endomucin's relatively high molecular weight (75-85 kDa), though the observed molecular weight may be higher than predicted due to extensive glycosylation. Transfer efficiency is maximized using PVDF membranes with pore sizes of 0.45 μm and transfer buffers containing 10-20% methanol at 25V overnight at 4°C . When probing the membrane, a primary antibody concentration of approximately 1 μg/mL is typically effective, with an overnight incubation at 4°C to maximize sensitivity and specificity. Multiple validated antibodies are available, including goat anti-mouse Endomucin antibodies that cross-react with rat Endomucin due to sequence homology . Signal detection sensitivity can be significantly improved using HRP-conjugated secondary antibodies with enhanced chemiluminescence substrates, particularly important when detecting low expression levels in certain tissues or experimental conditions.

How can researchers optimize immunofluorescence protocols for Rat Endomucin detection in tissue sections?

Optimizing immunofluorescence protocols for Rat Endomucin detection in tissue sections requires attention to several key methodological details. For fixation, 4% paraformaldehyde for 10-15 minutes at room temperature preserves both antigenicity and tissue architecture without excessive crosslinking that might mask Endomucin epitopes . Antigen retrieval is critical and is best performed using citrate buffer (pH 6.0) at 95°C for 20 minutes, followed by gradual cooling to room temperature to expose epitopes without tissue damage. Permeabilization should be gentle, using 0.1-0.2% Triton X-100 for 10 minutes, as stronger detergents can disrupt the membrane localization of Endomucin . Blocking with 5-10% normal serum from the secondary antibody host species for 1-2 hours effectively reduces background signal without interfering with specific binding. Primary antibodies should be incubated at concentrations of 5-10 μg/mL overnight at 4°C to maximize sensitivity while maintaining specificity . For fluorescent visualization, secondary antibodies conjugated to bright, photostable fluorophores like Alexa Fluor 488 or 594 at 1:500 dilution provide optimal signal-to-noise ratios. Counterstaining with DAPI helps visualize tissue architecture and cellular context, while mounting with anti-fade medium preserves fluorescence for extended imaging sessions .

How can Recombinant Rat Endomucin be utilized in angiogenesis and vascular development studies?

Recombinant Rat Endomucin serves as a valuable tool in angiogenesis and vascular development studies through multiple experimental approaches. In three-dimensional in vitro angiogenesis assays, coating culture surfaces with purified recombinant Endomucin at concentrations of 1-5 μg/cm² can significantly modulate endothelial tube formation, providing insights into its role in vascular morphogenesis. When studying endothelial cell migration, recombinant Endomucin can be used in Boyden chamber assays to assess its effects on directional cell movement in response to angiogenic stimuli. For functional blocking studies, recombinant Endomucin can be pre-incubated with specific antibodies (at 1:100 to 1:500 dilutions) to neutralize its activity before addition to endothelial cell cultures . In more advanced co-culture models with pericytes or smooth muscle cells, recombinant Endomucin treatment can reveal its role in vessel stabilization and maturation processes. Additionally, in wound healing assays, topical application of recombinant Endomucin at concentrations of 10-50 μg/mL can provide insights into its potential role in tissue repair and regeneration processes through modulation of vascular responses.

What strategies can be employed to study the interaction between Rat Endomucin and extracellular matrix components?

Studying the interaction between Rat Endomucin and extracellular matrix components requires sophisticated biochemical and cellular approaches. Solid-phase binding assays using purified recombinant Rat Endomucin immobilized on ELISA plates can quantitatively measure binding to individual matrix components like fibronectin, laminin, and collagens . Surface plasmon resonance (SPR) provides real-time kinetic data on Endomucin-ECM interactions, with typical experimental setups using 50-200 nM purified Endomucin flowed over immobilized matrix components. Cell adhesion assays comparing wild-type and Endomucin-depleted endothelial cells on various matrix substrates can reveal the functional consequences of these molecular interactions. Co-immunoprecipitation experiments using anti-Endomucin antibodies (at working concentrations of 1-5 μg per reaction) followed by mass spectrometry can identify novel binding partners in complex biological samples . For higher resolution analysis, proximity ligation assays in intact tissues can visualize Endomucin-ECM protein interactions at the molecular level with subcellular resolution. Additionally, atomic force microscopy can measure the actual binding forces between Endomucin and specific matrix components, providing mechanical insights into how this protein mediates cell-matrix interactions.

What are the recommended approaches for investigating Rat Endomucin phosphorylation states and their functional significance?

Investigating Rat Endomucin phosphorylation states and their functional significance requires integrated approaches combining biochemical and cellular techniques. Phospho-specific antibodies raised against predicted phosphorylation sites in rat Endomucin can be used in Western blotting with sensitivity enhanced by phospho-protein enrichment techniques prior to analysis . Mass spectrometry-based phosphoproteomics offers comprehensive mapping of all phosphorylation sites on Endomucin, typically requiring immunoprecipitation with validated anti-Endomucin antibodies followed by tryptic digestion and titanium dioxide enrichment of phosphopeptides. Site-directed mutagenesis of identified phosphorylation sites (serine, threonine, or tyrosine residues) to either phospho-deficient (S/T/Y to A) or phospho-mimetic (S/T to D/E) variants allows functional testing of specific phosphorylation events in cellular contexts . Kinase inhibitor screens can identify the specific kinases responsible for Endomucin phosphorylation, typically employing a panel of well-characterized inhibitors at concentrations determined by their known IC50 values. For temporal dynamics studies, pulse-chase experiments with radioactive phosphate (32P) incorporation followed by immunoprecipitation can track phosphorylation turnover rates under different physiological or pathological conditions. Finally, FRET-based biosensors incorporating Endomucin domains can provide real-time visualization of phosphorylation events in living cells.

How can researchers address antibody cross-reactivity issues when detecting Rat Endomucin in mixed species samples?

Addressing antibody cross-reactivity issues when detecting Rat Endomucin in mixed species samples requires systematic optimization and validation strategies. Pre-absorption of antibodies with recombinant proteins from non-target species can significantly reduce cross-reactivity, typically using a 5-10 fold molar excess of the competing protein during a 2-hour pre-incubation at room temperature . Western blot validation using samples from multiple species side-by-side can identify the extent of cross-reactivity and optimal antibody dilutions for specific detection. Epitope mapping of available antibodies helps select those targeting regions with higher sequence divergence between species, particularly focusing on the extracellular domain which shows greater variability than the more conserved cytoplasmic domain . For immunohistochemistry applications in mixed species tissues (such as xenografts), dual staining with species-specific markers can help distinguish true Endomucin signals from cross-reactive background. Using secondary antibodies pre-absorbed against serum proteins from non-target species further reduces non-specific binding. Additionally, knockout or knockdown validation controls are essential to confirm signal specificity, particularly when studying tissues with potentially confounding expression of related mucin family members.

What are common pitfalls in purification of Recombinant Rat Endomucin and how can they be overcome?

Purification of Recombinant Rat Endomucin presents several challenges that researchers should anticipate and address methodologically. Aggregation during purification is a common issue due to Endomucin's hydrophobic transmembrane domain; this can be mitigated by including mild non-ionic detergents (0.1% Triton X-100 or 0.5% CHAPS) in all purification buffers . Proteolytic degradation frequently occurs during expression and purification, requiring the addition of a protease inhibitor cocktail that includes both serine and cysteine protease inhibitors throughout the procedure. Heterogeneous glycosylation can result in multiple peaks during chromatography, necessitating lectin affinity chromatography as an additional purification step to separate differentially glycosylated forms. Low expression yields in recombinant systems may require optimization of codon usage for rat cell expression and consideration of fusion tags that enhance solubility like SUMO or thioredoxin . Endotoxin contamination is particularly problematic for functional studies, requiring additional purification steps such as Triton X-114 phase separation or specialized endotoxin removal columns when producing Endomucin for cell-based assays. Maintaining protein stability during storage often requires the addition of 10-20% glycerol and storage at -80°C in small aliquots to avoid repeated freeze-thaw cycles that can lead to activity loss.

How should researchers interpret and troubleshoot unexpected molecular weight variations of Rat Endomucin in Western blots?

Unexpected molecular weight variations of Rat Endomucin in Western blots can arise from multiple factors that require systematic troubleshooting. Post-translational modifications, particularly variable O-glycosylation patterns, can shift the apparent molecular weight significantly from the predicted 75-85 kDa range; enzymatic deglycosylation using PNGase F (for N-linked glycans) or O-glycosidase (for O-linked glycans) prior to Western blotting can confirm if glycosylation accounts for observed variations . Alternative splicing of Rat Endomucin mRNA may generate protein isoforms of different molecular weights; RT-PCR with isoform-specific primers can identify whether such variants are expressed in the tissue of interest. Sample preparation conditions, particularly the efficiency of protein denaturation and reduction, significantly affect migration patterns; increasing SDS concentration to 2% and DTT to 100 mM in the sample buffer can ensure complete denaturation . Proteolytic degradation during sample preparation can generate lower molecular weight fragments; this can be addressed by adding protease inhibitor cocktails to lysis buffers and maintaining samples at 4°C throughout processing. Aggregate formation due to insufficient reduction of disulfide bonds appears as higher molecular weight bands; extended heating (10 minutes at 95°C) in fresh reducing agent can break these interactions . Finally, antibody specificity issues might lead to detection of cross-reactive proteins; validation with alternative antibodies targeting different epitopes can confirm the identity of unexpected bands.

What statistical approaches are recommended for quantifying changes in Rat Endomucin expression across different experimental conditions?

Quantifying changes in Rat Endomucin expression across different experimental conditions requires robust statistical approaches appropriate for the specific detection method. For Western blot densitometry data, normalization to housekeeping proteins like β-actin or GAPDH is essential before applying statistical tests, with at least three biological replicates recommended for reliable analysis . One-way ANOVA followed by appropriate post-hoc tests (Tukey's or Dunnett's) is suitable for comparing multiple experimental groups, while paired t-tests are appropriate for before-after comparisons within the same samples. For immunohistochemistry quantification, measurement of staining intensity using standardized RGB thresholding across multiple fields (minimum 5-10 per sample) provides more reliable data than subjective scoring systems. Flow cytometry data for Endomucin expression is best analyzed using median fluorescence intensity rather than mean values, as it is less affected by outliers, with non-parametric tests like Mann-Whitney recommended for statistical comparisons . For qRT-PCR quantification of Endomucin mRNA, the 2^(-ΔΔCt) method with appropriate reference genes validated for stability under the experimental conditions provides reliable relative quantification. When correlating Endomucin expression with biological outcomes, regression analysis with confidence intervals and R² values offers more insight than simple correlation coefficients. Multi-variable analysis may be necessary when examining Endomucin in complex experimental systems with multiple changing parameters.

How can researchers accurately interpret Rat Endomucin localization patterns in various cell types and tissue contexts?

Accurately interpreting Rat Endomucin localization patterns requires consideration of cell type-specific context and careful control experiments. In endothelial cells, the primary cell type expressing Endomucin, proper interpretation requires co-localization studies with plasma membrane markers (CD31/PECAM-1) and components of vesicular trafficking pathways to distinguish surface from internalized protein pools . Quantitative co-localization analysis using Pearson's or Mander's coefficients provides objective measures of spatial relationships between Endomucin and other cellular structures. In tissues with heterogeneous cell populations, dual immunofluorescence with cell-type specific markers (CD31 for endothelial cells, α-SMA for smooth muscle cells) is essential to correctly identify which cells express Endomucin. Three-dimensional confocal reconstruction improves localization accuracy by eliminating the artifactual overlaps inherent in two-dimensional projections of complex tissues. Super-resolution microscopy techniques (STED, STORM) can resolve Endomucin distribution at sub-diffraction resolutions, revealing organization within membrane microdomains that is not visible with conventional microscopy . Live-cell imaging using fluorescently-tagged Endomucin constructs can track dynamic changes in localization in response to stimuli, though careful validation against endogenous protein patterns is required to avoid overexpression artifacts. Finally, electron microscopy immunogold labeling provides the highest resolution localization, particularly useful for resolving Endomucin distribution relative to specialized endothelial structures like fenestrations or caveolae.

What approaches can be used to correlate Rat Endomucin expression levels with functional vascular parameters in disease models?

Correlating Rat Endomucin expression levels with functional vascular parameters in disease models requires integrated multi-parameter analytical approaches. In vascular permeability studies, quantitative analysis of tracer extravasation (using Evans Blue dye or fluorescent dextrans) can be directly correlated with Endomucin expression levels in the same vascular beds using regression analysis . Laser Doppler flowmetry measurements of tissue perfusion combined with quantitative immunohistochemistry for Endomucin provides insights into the relationship between expression levels and microvascular flow patterns. Intravital microscopy enables simultaneous visualization of leukocyte-endothelial interactions and Endomucin distribution in living animals, allowing real-time correlation between expression patterns and functional leukocyte adhesion parameters. For angiogenesis studies, vessel density quantification using CD31 staining alongside Endomucin expression analysis can reveal correlations between expression levels and neovascularization in disease models . In more advanced setups, photoacoustic imaging can non-invasively monitor vascular function in deep tissues, with subsequent ex vivo analysis of Endomucin expression in the same regions providing structure-function relationships. Mathematical modeling approaches such as principal component analysis (PCA) or partial least squares regression (PLS-R) can identify complex relationships between multiple vascular parameters and Endomucin expression patterns not evident through simpler correlative statistics. Finally, longitudinal studies tracking both Endomucin expression and vascular function over disease progression provide more meaningful insights than single-timepoint correlations.

What are the most promising research directions for understanding Rat Endomucin's role in vascular development and disease?

The most promising research directions for understanding Rat Endomucin's role in vascular development and disease span multiple innovative approaches. Single-cell transcriptomic analysis of Endomucin expression in different endothelial subpopulations during development and disease progression can reveal previously unrecognized heterogeneity in expression patterns correlating with specific vascular phenotypes . The development of conditional knockout rat models using CRISPR/Cas9 technology targeting Endomucin in specific vascular beds would allow precise dissection of its tissue-specific functions without the confounding effects of global deletion. Investigation of Endomucin's potential roles in regulating mechanotransduction pathways in response to shear stress and other mechanical forces represents an emerging area connecting this protein to vascular adaptation mechanisms . Exploration of Endomucin's interactions with the glycocalyx and its contribution to endothelial barrier integrity in inflammatory contexts could reveal new therapeutic targets for vascular leakage syndromes. Examination of potential interactions between Endomucin and vascular progenitor cells during neovascularization might uncover roles in regulating stem cell homing and differentiation during vascular repair. Finally, comparative studies of Endomucin function across different species could highlight evolutionarily conserved mechanisms critical for vascular development and homeostasis, while identifying species-specific adaptations that inform the translation of findings between model organisms and humans.

How can integrating computational modeling with experimental data enhance our understanding of Rat Endomucin functions?

Integrating computational modeling with experimental data can substantially enhance our understanding of Rat Endomucin functions through multiple synergistic approaches. Molecular dynamics simulations of Endomucin's extracellular domain can predict conformational changes under different binding conditions, generating testable hypotheses about interaction mechanisms with extracellular matrix components and other binding partners . Systems biology approaches integrating transcriptomic, proteomic, and metabolomic data can position Endomucin within broader signaling networks, identifying unexpected regulatory relationships not evident from focused experimental studies. Machine learning algorithms applied to large datasets of Endomucin expression patterns across diverse tissue samples can identify subtle correlations with disease states or vascular phenotypes that might be missed by conventional statistical approaches . Agent-based modeling of endothelial cell behavior incorporating Endomucin's known molecular properties can simulate emergent vascular patterning processes during development and disease. Protein-protein interaction prediction tools can identify potential novel binding partners based on structural complementarity, guiding experimental validation efforts more efficiently than unbiased screening approaches. Pharmacophore modeling based on Endomucin's structure could facilitate virtual screening for compounds that might modulate its functions, accelerating therapeutic discovery. Finally, multi-scale modeling connecting molecular dynamics of Endomucin interactions to cellular behaviors and tissue-level vascular function can bridge the gap between molecular mechanisms and physiological outcomes, providing a more integrated understanding of this protein's diverse roles.

What are the key considerations for translating Rat Endomucin research findings to human vascular biology and potential therapeutic applications?

Translating Rat Endomucin research findings to human vascular biology and potential therapeutic applications requires careful consideration of several key factors. Comparative sequence and structural analysis between rat and human Endomucin is essential, particularly focusing on conserved functional domains and regulatory motifs that suggest preserved functions across species . Validation of key findings in human endothelial cell models and tissues is critical, as species-specific differences in glycosylation patterns and binding partners may alter functional outcomes despite sequence homology. Cross-species antibody validation using techniques like epitope mapping ensures that tools developed for rat studies can be reliably applied to human samples, or clearly identifies when species-specific reagents are required . Consideration of vascular bed heterogeneity in both species is crucial, as Endomucin's functions may vary between different vascular territories, requiring tailored approaches for specific clinical applications. Development of humanized animal models, such as immunodeficient rats engrafted with human endothelial cells, can provide more relevant platforms for testing therapeutic strategies targeting Endomucin before clinical translation. Careful analysis of Endomucin's role in pathological conditions with cross-species relevance, such as tumor angiogenesis or inflammatory vascular dysfunction, can identify the most promising translational opportunities. Finally, development of targeted delivery systems for Endomucin-modulating therapeutics must account for potential species differences in vascular permeability and accessibility of target endothelial populations in different disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.