Recombinant Rat Endothelin B receptor-like protein 2 (Gpr37l1)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Rat Endothelin B receptor-like protein 2 (Gpr37l1) is a synthetic, engineered form of the rodent GPR37L1 protein, a G-protein coupled receptor (GPCR) expressed in the nervous system. It is produced through cell-free expression systems for research purposes. The protein is also referred to as prosaposin receptor GPR37L1 or G protein-coupled receptor 37-like 1 .

Ligand Binding and Signaling

While the recombinant rat Gpr37l1 has not been directly studied in-depth, its human and murine homologs are activated by prosaposin and prosaptide, neuroprotective peptides that modulate G-protein signaling (e.g., ERK phosphorylation, cAMP inhibition) . These findings suggest potential applications for the recombinant rat protein in:

  • Ligand-receptor interaction studies

  • Signaling pathway elucidation (e.g., Gαs coupling)

  • High-throughput screening for novel agonists/antagonists

Neurological and Physiological Relevance

The endogenous GPR37L1 participates in:

  • Cerebellar development: Regulates granule neuron proliferation and Bergmann glia maturation

  • Neuropathic pain modulation: Interacts with potassium channels (e.g., KCNJ10) in satellite glial cells

  • Hypertension: Deletion models show precocious cerebellar development and blood pressure dysregulation

Comparative Analysis of Recombinant GPR37L1 Orthologs

ParameterRat Gpr37l1Mouse Gpr37l1Human GPR37L1
Host SystemCell-freeCell-freeHEK293/U87 glioblastoma
Purity≥85%≥85%Not explicitly stated
Key ApplicationsResearch in rodent modelsNeurological disease modelingNeuroprotection studies
Ligand BindingInferred (prosaposin)Confirmed (prosaposin)Confirmed (prosaposin)

Data synthesized from

Research Challenges and Future Directions

  • Limitations:

    • Structural ambiguity: N-terminal proteolytic processing observed in human GPR37L1 may affect rat ortholog behavior.

    • Receptor-specific ligands: Maresin 1 (a lipid mediator) recently identified as a GPR37L1 ligand in satellite glial cells warrants testing in recombinant rat models.

  • Opportunities:

    • Therapeutic targeting: GPR37L1 variants linked to chronic pain and epilepsy could be studied using recombinant proteins.

    • Molecular dynamics: Cell-free production enables structural studies of receptor-ligand interactions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gpr37l1; Etbrlp2; G-protein coupled receptor 37-like 1; Endothelin B receptor-like protein 2; ETBR-LP-2; G-protein coupled receptor CNS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-481
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
AATLSLGGHRAKVQEQQSRPRRGTKDEGPKEVQHYVPEEWAEYPKPIHPAGLQPTKPLVA TSPNPDKDGATSESGQELRTNLTGTPSQRLQIQNPLYPVTESSYSAYAVMLLALVVFAVG IVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVLFFCLPIVIFNEITKQRLLGDVSCR AVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVRPIERCQSILAKLAVIWVGSMMLAV PELLLWQLAQEPTPTMGTVDSCIMKPSADLPESLYSLVMTYQNARMWWYFGCYFCLPILF TVTCQLVTWRVRGPPGRKPECRAGRHEQCESQLNSTVVGLTVVYAFCTLPENICNIVVAY LSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCICRPLGQAFLDCCCCCCCEECGGASD SSATVSADSKLKAEVSSSIYFHKPRESPPLLPLGTPC
Uniprot No.

Target Background

Function

G-protein coupled receptor. Studies indicate GPR37L1 binds the neuroprotective and glioprotective factor prosaposin (PSAP), triggering endocytosis and an ERK phosphorylation cascade. However, other research suggests prosaposin does not enhance activity. GPR37L1 is hypothesized to be a constitutively active receptor signaling through the Gsα subunit. It plays a role in regulating postnatal cerebellar development by modulating the Shh pathway, influencing baseline blood pressure in females, and offering cardiovascular stress protection in males. Furthermore, it mediates the inhibition of astrocyte glutamate transporters and reduces neuronal NMDA receptor activity.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, cilium membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in brain.

Q&A

What is Gpr37l1 and where is it primarily expressed?

Gpr37l1 (G protein-coupled receptor 37-like 1) is an orphan G protein-coupled receptor that is almost exclusively expressed in the nervous system. It shows particularly strong expression in cerebellar Bergmann glia astrocytes during both development and adulthood. The receptor was previously considered orphan (without known ligands) until recent studies identified prosaptide and its parent molecule prosaposin as endogenous ligands. Gpr37l1 belongs to the GPCR superfamily and shares structural similarities with endothelin B receptors, though it has distinct signaling properties and physiological roles focused in glial and neuronal development and protection .

What are the known ligands for Gpr37l1?

Research has identified prosaptide and its parent molecule prosaposin (also known as sulfated glycoprotein-1) as endogenous ligands for Gpr37l1. Prosaptide is the active fragment of prosaposin and has been shown to promote receptor endocytosis, bind directly to the receptor, and activate downstream signaling in a Gpr37l1-dependent manner. Both prosaptide and full-length prosaposin stimulate Gpr37l1 signaling and demonstrate protective effects against oxidative stress in primary astrocytes. These protective effects are significantly attenuated when Gpr37l1 is knocked down by siRNA, confirming the receptor-ligand relationship. This discovery was significant as it transformed Gpr37l1 from an orphan receptor to one with identified physiological ligands .

What are the most effective methods for studying Gpr37l1 signaling in vitro?

For investigating Gpr37l1 signaling in vitro, several complementary approaches have proven effective:

  • Receptor endocytosis assays: Monitoring ligand-induced internalization of fluorescently tagged Gpr37l1 provides a visual readout of receptor activation.

  • ERK phosphorylation assays: Western blotting for phosphorylated ERK following prosaptide or prosaposin stimulation provides quantitative assessment of Gpr37l1 signaling. Pertussis toxin sensitivity tests can confirm G protein involvement.

  • GTPγS binding assays: Measuring 35S-GTPγS binding following receptor stimulation directly assesses G protein activation.

  • cAMP inhibition assays: Measuring the inhibition of forskolin-stimulated cAMP production assesses Gpr37l1-mediated inhibitory G protein signaling.

  • Knockdown validation: siRNA-mediated knockdown of Gpr37l1 in cells that endogenously express the receptor (such as primary astrocytes) followed by ligand stimulation confirms receptor-specific effects .

These methods can be complemented with recombinant protein expression systems, where HEK293 cells (which show no endogenous response to prosaptide/prosaposin) are transfected with Gpr37l1 to establish gain-of-function models.

How can Gpr37l1 knockout models be effectively generated and validated?

Generating effective Gpr37l1 knockout models requires careful consideration of strategy, validation, and phenotypic analysis:

  • Genetic strategy: Complete gene ablation can be achieved through homologous recombination targeting critical exons of the Gpr37l1 gene. CRISPR/Cas9 approaches offer more targeted and efficient alternatives to traditional methods.

  • Validation techniques:

    • Genomic PCR to confirm appropriate targeting

    • RT-PCR and qPCR to verify absence of mRNA expression

    • Western blotting to confirm absence of protein expression

    • Immunohistochemistry to verify loss of expression in expected tissues (particularly cerebellar Bergmann glia)

  • Phenotypic assessment: Based on published models, carefully examine:

    • Cerebellar development, particularly timing of granule neuron precursor proliferation

    • Bergmann glia and Purkinje neuron maturation rates

    • Motor coordination and learning abilities using rotarod and other behavioral tests

    • Expression levels of Sonic hedgehog pathway components

    • Cellular responses to oxidative stress challenges

Beyond complete knockouts, conditional and inducible knockout strategies can help distinguish developmental from adult functions of Gpr37l1 and avoid potential compensatory mechanisms.

What are the key considerations when working with recombinant Gpr37l1 protein?

When working with recombinant Gpr37l1 protein, researchers should consider:

  • Expression system selection: Mammalian expression systems (particularly HEK293 cells) provide appropriate post-translational modifications and proper folding compared to bacterial systems. This is critical since misfolded GPCRs can aggregate and cause cellular stress.

  • Fusion tags and purification strategy:

    • C-terminal fusion tags (such as Fc) are generally preferred to avoid interfering with the N-terminal ligand binding domain

    • His tags facilitate purification but may affect protein function

    • Purification should be validated by SDS-PAGE and Western blotting

  • Stability and storage:

    • Lyophilized proteins typically maintain stability for up to 12 months at -20°C to -80°C

    • Reconstituted protein solutions should be stored at 4-8°C for short-term (2-7 days) use

    • For longer storage, aliquots should be maintained at <-20°C to avoid freeze-thaw cycles

  • Functional validation:

    • Binding assays with known ligands (prosaptide/prosaposin)

    • Co-immunoprecipitation studies with known interacting partners (e.g., patched 1)

    • Verification of biological activity in appropriate cell models

  • Quality control:

    • Endotoxin testing (<1.0 EU per μg) using LAL method

    • Purity assessment (>85% by reducing SDS-PAGE)

    • Appropriate molecular weight confirmation (predicted vs. apparent)

How does Gpr37l1 interact with the Sonic hedgehog (Shh) signaling pathway?

Gpr37l1 exhibits significant interactions with the Sonic hedgehog (Shh) signaling pathway, particularly during postnatal cerebellar development:

  • Physical interaction with Patched 1: Research demonstrates that Gpr37l1 specifically interacts and colocalizes with Patched 1 (Ptch1), the primary receptor for Shh. This interaction occurs in Bergmann glia cells, where Gpr37l1 is associated with primary cilium membranes.

  • Modulation of Shh signaling: Knockout studies reveal that Gpr37l1 ablation results in altered expression of several components of the Shh mitogenic pathway in cerebellar samples. This suggests Gpr37l1 participates in regulating Shh signal transduction.

  • Developmental consequences: The absence of Gpr37l1 leads to premature down-regulation of granule neuron precursor proliferation and precocious maturation of Bergmann glia and Purkinje neurons, consistent with modified Shh signaling.

  • Functional outcomes: These developmental alterations are associated with improved juvenile motor abilities and enhanced adult motor learning and coordination, indicating that Gpr37l1's regulation of Shh signaling has significant long-term functional consequences .

The interaction between Gpr37l1 and Shh signaling represents an important regulatory mechanism in cerebellar development, with Gpr37l1 appearing to modulate the strength or duration of Shh pathway activation during critical developmental windows.

What G protein-dependent signaling pathways are activated by Gpr37l1?

Gpr37l1 activates several G protein-dependent signaling pathways upon stimulation by its ligands prosaptide and prosaposin:

  • Gi/o protein coupling: Gpr37l1 signaling exhibits sensitivity to pertussis toxin, indicating coupling to inhibitory Gi/o proteins. This coupling leads to:

    • Inhibition of adenylyl cyclase activity

    • Reduction in forskolin-stimulated cAMP production

    • Promotion of GTPγS binding to G proteins

  • ERK pathway activation: Stimulation of cells expressing Gpr37l1 with prosaptide or prosaposin induces phosphorylation of ERK in a pertussis toxin-sensitive manner, suggesting this pathway is downstream of Gi/o protein activation.

  • Protective signaling: Both prosaptide and prosaposin protect primary astrocytes against oxidative stress through Gpr37l1-dependent mechanisms, though the exact intracellular mediators of this protection remain incompletely characterized.

  • Potential receptor-specific signaling: Evidence suggests Gpr37 and Gpr37l1 may not couple to exactly the same set of intracellular signaling pathways. For example, knockdown studies indicate that while GPR37 appears necessary for prosaptide/prosaposin-induced ERK phosphorylation in astrocytes, both GPR37 and GPR37L1 are required for protection against oxidative stress .

This suggests that Gpr37l1 may activate additional signaling pathways beyond those shared with Gpr37, which could explain their non-redundant physiological roles despite responding to the same ligands.

What protein-protein interactions are critical for Gpr37l1 function?

Several key protein-protein interactions are essential for Gpr37l1 function:

  • Patched 1 (Ptch1) interaction: Gpr37l1 specifically interacts and colocalizes with Ptch1 in Bergmann glia cells. This interaction appears to be functionally significant for modulating Sonic hedgehog signaling during cerebellar development. The protein-protein interaction has been demonstrated through co-immunoprecipitation studies and colocalization in primary cilium membranes .

  • G protein coupling: Gpr37l1 couples to inhibitory G proteins (Gi/o family), as evidenced by pertussis toxin sensitivity of its signaling. This coupling is essential for:

    • Inhibition of adenylyl cyclase

    • Activation of ERK signaling

    • Mediation of neuroprotective effects

  • Ligand interactions: Prosaptide and prosaposin bind directly to Gpr37l1, triggering receptor activation and endocytosis. This interaction is specific and sufficient to initiate downstream signaling cascades .

  • Potential dimerization: Though not explicitly documented in the search results, many GPCRs form homo- or heterodimers as part of their functional regulation. Given the co-expression of Gpr37 and Gpr37l1 in some neural tissues, potential heterodimerization may contribute to their differential signaling properties.

These interactions collectively determine the receptor's ability to sense extracellular signals (prosaposin/prosaptide), initiate intracellular signaling cascades, and modulate critical developmental pathways like Sonic hedgehog signaling.

What role does Gpr37l1 play in cerebellar development?

Gpr37l1 serves as a critical regulator of postnatal cerebellar development:

  • Temporal regulation of neural precursor proliferation: Gpr37l1 knockout studies demonstrate that the receptor regulates the timing of granule neuron precursor (GNP) proliferation. Ablation of the Gpr37l1 gene results in premature down-regulation of GNP proliferation, suggesting the receptor normally helps sustain appropriate proliferation periods.

  • Maturation timing of cerebellar cell types: Gpr37l1 influences the maturation timing of:

    • Bergmann glia: Precocious maturation in knockout mice

    • Purkinje neurons: Accelerated maturation and layer formation in knockout models

  • Sonic hedgehog pathway modulation: Gpr37l1 regulates postnatal cerebellar development by modulating the Sonic hedgehog signaling pathway. It physically interacts with the Shh primary receptor Patched 1, and Gpr37l1 knockout leads to altered expression of several Shh pathway components.

  • Functional consequences: These developmental alterations result in:

    • Precocious juvenile motor abilities

    • Improved adult motor learning and coordination

This evidence collectively indicates that Gpr37l1 participates in establishing the proper timing and sequence of cerebellar development events, likely by fine-tuning Shh signaling strength and duration during critical developmental windows .

How is Gpr37l1 involved in neuroprotection and glioprotection?

Gpr37l1 plays significant roles in neuroprotection and glioprotection through multiple mechanisms:

  • Mediation of protective signaling: Gpr37l1 serves as a receptor for the neuroprotective and glioprotective factors prosaptide and prosaposin. When activated by these ligands, Gpr37l1 initiates signaling cascades that promote cell survival.

  • Oxidative stress protection: Both prosaptide and prosaposin protect primary astrocytes against hydrogen peroxide (H₂O₂)-induced oxidative stress and cell death. This protection is significantly attenuated when Gpr37l1 is knocked down by siRNA, demonstrating the receptor's necessary role in this protective response.

  • Distinctive protective pathways: While ERK phosphorylation appears to be one downstream effect of Gpr37l1 activation, the protective effects against oxidative stress likely involve additional signaling pathways. This is evidenced by the finding that both Gpr37 and Gpr37l1 are necessary for the full protective effect of prosaptide/prosaposin, while only Gpr37 appears necessary for ERK phosphorylation.

  • Physiological significance: The neuroprotective and glioprotective functions of Gpr37l1 likely represent its predominant role under normal physiological conditions, in contrast to the potentially deleterious effects of Gpr37 overexpression in certain pathological contexts (e.g., when parkin is absent or when the receptor is highly overexpressed) .

These protective functions suggest that Gpr37l1 may represent a potential therapeutic target for conditions involving oxidative stress and neuronal/glial damage.

What associations exist between Gpr37l1 variants and neurological disorders?

Emerging evidence suggests potential associations between Gpr37l1 genetic variants and neurological disorders:

  • Epilepsy and migraine associations: Unbiased computational analysis of rare Gpr37l1 coding variants from the DiscovEHR cohort (51,289 whole-exome sequences) revealed significant associations with disease diagnostic codes for epilepsy and migraine. This suggests Gpr37l1 may play roles in seizure susceptibility and pain processing.

  • Genetic variant analysis approach: The study binned rare Gpr37l1 coding variants according to predicted pathogenicity and analyzed them using sequence kernel association testing to identify disease correlations. While these associations do not prove causality, they provide direction for further investigation.

  • Functional validation: Rare Gpr37l1 variants were functionally analyzed to determine their impact on receptor activity, providing insights into potential mechanistic links between variant functions and disease manifestations .

  • Developmental considerations: Given Gpr37l1's established role in cerebellar development and its interaction with the Sonic hedgehog pathway, developmental effects of variant receptors may contribute to neurological phenotypes through altered brain structure or circuit formation.

These emerging associations highlight the potential clinical relevance of Gpr37l1 research and suggest that modulation of this receptor's activity might have therapeutic applications in certain neurological conditions.

What are the critical differences between human and rat Gpr37l1 that might impact translational research?

When conducting translational research involving Gpr37l1, researchers must consider several important species differences:

When designing translational studies, validation of key findings across species is essential. Approaches that combine recombinant protein work with endogenous receptor studies in both species provide the most robust translational insights.

How can apparent contradictions in Gpr37l1 knockout phenotypes be reconciled?

Reconciling contradictory phenotypes observed in Gpr37l1 knockout studies requires careful consideration of several experimental and biological factors:

  • Developmental timing effects:

    • Gpr37l1's role appears to change during different developmental stages

    • Precocious cerebellar development (seen in knockout models) may have different consequences than acute receptor inactivation in adult animals

    • Consider using inducible knockout systems to distinguish developmental from adult functions

  • Compensatory mechanisms:

    • Germline knockouts may trigger compensatory upregulation of related systems (particularly Gpr37)

    • Acute knockdown using siRNA or pharmacological inhibition may reveal different phenotypes than chronic gene deletion

    • Combined Gpr37/Gpr37l1 double knockout studies may clarify redundant functions

  • Context-dependent signaling:

    • Improvements in motor coordination in knockout mice juxtaposed with potential associations with neurological disorders in humans may reflect context-dependent functions

    • The receptor may have protective functions during stress conditions while serving regulatory (potentially constraining) functions during development

    • Different downstream pathways may be preferentially activated in different physiological contexts

  • Methodological considerations:

    • Differences in knockout strategy (complete vs. conditional)

    • Genetic background variations between mouse strains

    • Differences in phenotypic assessment methods and timing

A comprehensive research approach should include multiple complementary techniques to establish a more complete understanding of Gpr37l1 function across different contexts.

What are the most promising approaches for developing Gpr37l1-targeted therapeutics?

Development of Gpr37l1-targeted therapeutics presents both opportunities and challenges that can be addressed through several complementary approaches:

  • Ligand-based drug design strategies:

    • Structure-activity relationship studies of prosaptide derivatives to identify minimal bioactive sequences

    • Development of peptidomimetics with enhanced stability and blood-brain barrier penetration

    • High-throughput screening for small molecule agonists or positive allosteric modulators

  • Structure-based approaches:

    • Computational modeling of Gpr37l1 structure based on related GPCRs with known crystal structures

    • Molecular docking studies to identify potential binding pockets beyond the orthosteric site

    • Fragment-based screening to identify chemical scaffolds with binding potential

  • Targeted indications based on biological functions:

    • Neuroprotective applications: Ischemic stroke, traumatic brain injury, neurodegenerative diseases

    • Developmental disorders: Conditions with cerebellar dysfunction or motor coordination deficits

    • Epilepsy and migraine: Based on genetic association data with rare Gpr37l1 variants

  • Delivery considerations:

    • Blood-brain barrier penetration strategies for CNS targeting

    • Cell-specific delivery approaches to target Bergmann glia or other Gpr37l1-expressing cells

    • Sustained release formulations for chronic conditions requiring long-term receptor modulation

  • Therapeutic modulation strategies:

    • Direct agonism to mimic prosaptide/prosaposin effects

    • Positive allosteric modulation to enhance endogenous ligand activity

    • Targeted protein degradation approaches for conditions where receptor downregulation might be beneficial

The development pathway should include careful validation in both in vitro and in vivo models, with particular attention to potential differences between species in drug response .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.