Recombinant Rat Ephrin-B1 (Efnb1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Signaling Mechanisms

Ephrin-B1 belongs to the B subclass of ephrin ligands, which interact with EphB receptors to mediate bidirectional signaling. Key functions include:

  • Bone Metabolism: Overexpression in transgenic mice (Col3.6-Tg efnb1) increases trabecular bone volume, enhances osteoblast differentiation, and suppresses osteoclast activity .

  • Axon Guidance: Induces growth cone collapse in commissural neurons, guiding axonal navigation during neural development .

  • Angiogenesis: Regulates vascular endothelial cell migration and capillary plexus formation .

Production and Purification

Recombinant Rat Ephrin-B1 is produced via transient or stable transfection in HEK293 cells, with the following workflow:

  1. Cloning: Insertion of rat efnb1 cDNA into mammalian expression vectors.

  2. Expression: Culturing in serum-free media to optimize protein yield.

  3. Purification: Nickel-affinity chromatography (via His tag) followed by size-exclusion chromatography.

  4. Quality Control: SDS-PAGE, Western blot, and binding assays to validate activity .

Bone Homeostasis

Transgenic mice overexpressing Ephrin-B1 under a collagen 1A1 promoter exhibited:

ParameterWild-TypeCol3.6-Tg efnb1Fold Change
Trabecular Bone VolumeBaseline↑↑↑6–14×
Osteoblast ActivityBaseline↑ Collagen 1A1, Osterix12× in osteoblasts
Osteoclast FormationBaseline↓ (via EphB2-Fc inhibition)76% reduction

Mechanical loading further amplified bone formation in transgenic mice, suggesting therapeutic potential for osteoporosis .

Cellular Signaling

  • Forward Signaling: Ephrin-B1 binding to EphB receptors activates receptor tyrosine kinase activity, promoting cell adhesion and survival.

  • Reverse Signaling: Ephrin-B1 transmembrane domain engagement triggers intracellular signaling in ligand-expressing cells, regulating cell migration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Efnb1; Eplg2; Lerk2; Ephrin-B1; EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-345
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Efnb1
Target Protein Sequence
ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDTDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGDSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Uniprot No.

Target Background

Function
Ephrin-B1 (Efnb1) is a cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases crucial for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Binding to Eph receptors on adjacent cells triggers contact-dependent bidirectional signaling between neighboring cells. Ephrin-B1 exhibits high affinity for the receptor tyrosine kinase EPHB1/ELK. It can also bind to EPHB2 and EPHB3. Ephrin-B1 binds to and induces the collapse of commissural axons/growth cones in vitro. It may play a role in regulating the orientation of longitudinally projecting axons.
Database Links
Protein Families
Ephrin family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.; [Ephrin-B1 C-terminal fragment]: Cell membrane; Single-pass type I membrane protein.; [Ephrin-B1 intracellular domain]: Nucleus.
Tissue Specificity
Detected in lung, kidney, heart and testis.

Q&A

Basic Research Questions

  • What is Ephrin-B1 (Efnb1) and what are its key functions?

    Ephrin-B1 (Efnb1) is a member of the ephrin family of transmembrane ligands that interact with Eph receptor tyrosine kinases. It belongs to the B class of ephrins, characterized by an intracellular region containing multiple tyrosine residues and a PDZ domain binding motif . Ephrin-B1 was initially identified as an Eph receptor-binding protein and as a retinoic acid (RA)-responsive gene .

    Key functions include:

    • Mediating cell-cell interactions during development

    • Establishing tissue boundaries, particularly at the developing coronal suture

    • Participating in bidirectional signaling with Eph receptors

    • Contributing to neural crest cell migration and differentiation

    • Guiding embryonic patterning in multiple tissues

    The gene encoding Ephrin-B1 (EFNB1 in humans, Efnb1 in mice and rats) is located on the X chromosome, which has important implications for its expression patterns and associated developmental disorders .

  • How is Ephrin-B1 expression regulated during development?

    Ephrin-B1 is expressed broadly, albeit not ubiquitously, during embryogenesis, with expression decreasing in adulthood . This pattern suggests a critical role during embryonic development. In mice, Efnb1 is prominently expressed in:

    • Frontonasal neural crest cells

    • Regions demarcating the position of the future coronal suture

    • Various neural crest-derived tissues including palatal shelves

    • Developing limb buds

    Regulation occurs through multiple mechanisms:

    • Retinoic acid responsiveness (identified as an RA-responsive gene)

    • Developmental stage-specific transcription factors

    • Tissue-specific enhancer elements

    • Epigenetic modifications during different developmental stages

    In females, Ephrin-B1 expression is further complicated by X-inactivation, resulting in mosaic expression patterns that can influence developmental outcomes .

  • What is the relationship between Ephrin-B1 and its receptors in signaling pathways?

    Ephrin-B1 interacts primarily with EphB receptors to generate bidirectional signals critical for numerous developmental processes:

    • Forward signaling: When Ephrin-B1 binds to an EphB receptor, it triggers receptor clustering, autophosphorylation, and activation of downstream signaling cascades in the receptor-expressing cell.

    • Reverse signaling: Upon binding to EphB receptors, Ephrin-B1's cytoplasmic domain becomes phosphorylated on tyrosine residues, initiating signaling cascades within the Ephrin-B1-expressing cell. The PDZ domain binding motif at the C-terminus also mediates protein interactions independent of tyrosine phosphorylation .

    This bidirectional signaling capacity allows for complex cell-cell communication during development and is essential for proper tissue boundary formation, cell migration, and other developmental processes.

  • What animal models have been most informative for studying Ephrin-B1 function?

    Several animal models have provided valuable insights into Ephrin-B1 function:

    Conventional knockout mice:

    • Efnb1-null mice exhibit cleft palate, shortening of the skull, sternal abnormalities, and omphalocele

    • Heterozygous female mice display more severe phenotypes (including polydactyly and syndactyly) than hemizygous males

    • Male knockout mice show significantly higher viability (15%) compared to heterozygous females (1-2%)

    Conditional knockout models:

    • Neural crest-specific deletion (Efnb1 NCC) using Wnt1-Cre results in cleft palate and defects in other neural crest-derived tissues, such as the tympanic ring of the middle ear

    • Crosses between conditional ephrin-B1 animals (ephrin-B1 lox/+) and Meox2-Cre mice produce broad embryonic deletion with varying viability rates depending on genetic background, as shown in the following table :

    GenotypeBackgroundExpectedRecoveredViability (%)
    ♂ ephrin-B1 Y/lox; Meox2 Cre/+Mixed13.75858%
    ♀ ephrin-B1 +/lox; Meox2 Cre/+Mixed13.7517.2%
    ♂ ephrin-B1 Y/lox; Meox2 Cre/+12910.3219.4%
    ♀ ephrin-B1 +/lox; Meox2 Cre/+12910.3219.4%

    Signaling-specific mutants:

    • Mice with mutations that specifically disrupt reverse signaling demonstrate the importance of this signaling direction for normal development

Advanced Research Questions

  • How does Ephrin-B1 signaling specifically affect neural crest cell development?

    Ephrin-B1 plays critical cell-autonomous roles in neural crest cell (NCC) development through several mechanisms:

    • Cell migration guidance: Ephrin-B1 controls directional migration of NCCs from the neural tube to their target locations through repulsive and attractive interactions with Eph receptors.

    • Tissue boundary establishment: At the developing coronal suture, Ephrin-B1 expression helps establish boundaries between different cell populations, which is crucial for proper morphogenesis.

    • Cell sorting mechanisms: In heterozygous females, mosaic expression of Ephrin-B1 (due to random X-inactivation) leads to abnormal sorting between Ephrin-B1-positive and Ephrin-B1-negative cells, disrupting tissue organization.

    Evidence for these roles comes from conditional knockout studies where Ephrin-B1 was deleted specifically in NCCs using Wnt1-Cre recombination. These mutants exhibited defects in NCC-derived tissues, including cleft palate and abnormalities in the tympanic ring of the middle ear, confirming that Ephrin-B1 is required cell-autonomously in NCCs .

  • What are the molecular mechanisms underlying the paradoxical inheritance pattern of EFNB1 mutations?

    EFNB1 mutations cause craniofrontonasal syndrome (CFNS), which shows the unusual pattern of greater severity in heterozygous females than in hemizygous males . This paradoxical inheritance is explained by the following mechanisms:

    • Cellular interference: In heterozygous females, random X-inactivation creates a mosaic of cells either expressing or lacking functional Ephrin-B1. This leads to abnormal cell sorting and boundary formation between patches of cells with different Ephrin-B1 expression status.

    • Tissue boundary disruption: The mosaic expression particularly disturbs tissue boundary formation at the developing coronal suture, leading to craniosynostosis (premature fusion of sutures) .

    • Compensatory mechanisms in males: In hemizygous males with complete lack of Ephrin-B1, alternative signaling pathways may compensate for Ephrin-B1 deficiency, maintaining relatively normal boundary formation. This explains why males typically only display hypertelorism rather than the severe craniofacial defects seen in females .

    Analysis of X-inactivation patterns in females with CFNS revealed that X-inactivation is not markedly skewed in either blood or cranial periosteum, indicating that lack of ephrin-B1 does not compromise cell viability in these tissues . This supports the cellular interference model rather than cell-autonomous lethal effects.

  • How do researchers distinguish between forward and reverse signaling in experimental systems?

    Distinguishing between forward and reverse signaling in the Ephrin-B1/Eph receptor system requires specialized experimental approaches:

    • Soluble fusion proteins:

      • EphB-Fc chimeras (such as Recombinant Rat EphB1 Fc Chimera Protein) can activate only reverse signaling through Ephrin-B1 without triggering forward signaling

      • These chimeric proteins typically contain the extracellular domain of EphB receptors fused to an immunoglobulin Fc region

      • Carrier-free versions are available for applications where the presence of carrier proteins like BSA could interfere

    • Mutant constructs:

      • Truncated Ephrin-B1 lacking the cytoplasmic domain can participate in forward signaling but cannot transduce reverse signals

      • Point mutations in tyrosine phosphorylation sites or the PDZ binding motif can selectively disrupt specific aspects of reverse signaling

    • Cell-based assays:

      • Co-culture systems with cells expressing only Ephrin-B1 or only Eph receptors

      • Analysis of signaling events in each cell population separately

      • Phosphorylation-specific antibodies to monitor activation of distinct signaling pathways

    • In vivo models:

      • Knock-in mice expressing signaling-deficient forms of Ephrin-B1 that can still activate receptors

      • Tissue-specific knockout of Ephrin-B1 or Eph receptors to determine which signaling direction is required in which cell type

  • What techniques are most effective for studying Ephrin-B1 expression patterns during development?

    Multiple complementary techniques provide comprehensive analysis of Ephrin-B1 expression:

    • Immunohistochemistry/Immunofluorescence:

      • Detects Ephrin-B1 protein localization at cellular and subcellular levels

      • Can be combined with markers for specific cell populations or structures

      • Allows assessment of phosphorylation status using phospho-specific antibodies

    • In situ hybridization:

      • Visualizes Efnb1 mRNA expression in tissue sections

      • Particularly valuable for developmental studies tracking gene expression across stages

      • Can be performed as chromogenic or fluorescent (FISH) procedures

    • Reporter gene systems:

      • Transgenic animals with reporter genes (e.g., LacZ, GFP) under Efnb1 promoter control

      • Useful for lineage tracing and real-time visualization in living tissues

      • Can reveal dynamic expression changes during development

    • 3D imaging approaches:

      • Whole-mount techniques combined with tissue clearing

      • Light-sheet microscopy for comprehensive 3D visualization

      • Digital reconstruction of expression patterns across entire embryos

    • Single-cell analysis:

      • Single-cell RNA sequencing to identify specific cell populations expressing Efnb1

      • Spatial transcriptomics to preserve anatomical context

      • Mass cytometry for simultaneous detection of Ephrin-B1 and associated signaling molecules

    These methods have revealed that murine Efnb1 is expressed in the frontonasal neural crest and demarcates the position of the future coronal suture, consistent with its role in craniofacial development .

  • How can researchers optimize experiments using recombinant Ephrin-B1 proteins?

    Successful experiments with recombinant Ephrin-B1 require careful attention to handling and experimental design:

    • Reconstitution and storage:

      • Lyophilized recombinant proteins should be reconstituted at approximately 200 μg/mL in sterile PBS

      • After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles

      • Store at -20°C to -80°C for long-term stability, using a manual defrost freezer

      • For cell culture applications, the version with carrier protein (typically BSA) is preferred for enhanced stability

    • Pre-clustering considerations:

      • For many applications, pre-clustering of Ephrin-B1-Fc with anti-Fc antibodies improves activity

      • This mimics the natural membrane-bound presentation of ephrin ligands

      • Typically achieved by incubating the recombinant protein with anti-Fc antibodies at a 1:2 to 1:10 molar ratio

    • Carrier-free applications:

      • Carrier-free (CF) versions are recommended for applications where BSA might interfere

      • These preparations lack bovine serum albumin (BSA) or other carrier proteins

      • Critical for certain imaging techniques, protein-protein interaction studies, or mass spectrometry

    • Concentration optimization:

      • Optimal working concentrations should be determined empirically for each application

      • Typical effective concentrations range from 0.1-10 μg/mL depending on the assay

      • Dose-response experiments are recommended when establishing new protocols

  • What are the most informative phenotypic analyses for Ephrin-B1 mutant models?

    Comprehensive phenotypic analysis of Ephrin-B1 mutant models should include:

    • Craniofacial assessment:

      • Micro-CT scanning to visualize skull morphology and suture patency

      • Histological analysis of cranial sutures to detect premature fusion (craniosynostosis)

      • Morphometric measurements of facial features, particularly hypertelorism

      • Assessment of palatal development and potential clefting

    • Skeletal analysis:

      • Whole-mount skeletal preparations using alizarin red/alcian blue staining

      • Evaluation of limb development for polydactyly and syndactyly

      • Examination of sternal formation and potential abnormalities

      • Quantification of bone density and architecture

    • Cellular studies:

      • Cell migration assays using neural crest cells isolated from mutant embryos

      • Analysis of cell sorting behaviors in heterozygous female tissues

      • Examination of tissue boundaries, particularly at the developing coronal suture

      • Assessment of cell proliferation and apoptosis in affected tissues

    • Molecular analyses:

      • Phosphorylation status of Ephrin-B1 and downstream signaling molecules

      • Expression profiling to identify dysregulated genes

      • Protein-protein interaction studies to assess disruption of normal binding partners

      • Chromatin immunoprecipitation to identify potential transcriptional effects

    Interestingly, analysis should account for sex differences, as heterozygous female mice exhibit more severe phenotypes (including polydactyly and syndactyly) and lower viability (1-2%) compared to hemizygous males (15% viability) .

Methodological Questions

  • What approaches can be used to study the bidirectional signaling properties of Ephrin-B1?

    Investigating bidirectional signaling requires specialized experimental strategies:

    • Biochemical approaches:

      • Phosphorylation analysis using phospho-specific antibodies against tyrosine residues in Ephrin-B1's cytoplasmic domain

      • Immunoprecipitation followed by mass spectrometry to identify binding partners

      • Protein-protein interaction assays (e.g., pull-down assays, FRET, proximity ligation)

      • Subcellular fractionation to track signaling complex formation

    • Genetic manipulation:

      • Expression of truncated or mutated forms of Ephrin-B1 lacking specific signaling domains

      • CRISPR/Cas9-mediated introduction of point mutations affecting key signaling residues

      • Creation of chimeric proteins to isolate specific signaling functions

      • Rescue experiments in knockout cells with selectively disabled signaling variants

    • Cell-based functional assays:

      • Cell adhesion and migration assays using stripe patterns of EphB receptors

      • Cell sorting assays mixing cells with different Ephrin-B1 expression status

      • Growth cone collapse assays in neuronal cultures

      • Time-lapse imaging of cellular responses to receptor engagement

    • In vivo approaches:

      • Creation of knock-in mice with mutations in specific signaling domains

      • Tissue-specific expression of dominant-negative forms of Ephrin-B1

      • Ex vivo culture of embryonic tissues with application of blocking reagents

      • Electroporation of constructs into developing embryos for acute manipulation

  • How should researchers design experiments to study X-inactivation effects in Ephrin-B1 heterozygous models?

    Studying the effects of X-inactivation in Ephrin-B1 heterozygous models requires specialized approaches:

    • Visualizing mosaic expression:

      • X-chromosome-linked fluorescent reporters to track X-inactivation patterns

      • Immunostaining to directly visualize patches of Ephrin-B1-positive and negative cells

      • In situ hybridization combined with immunohistochemistry to assess transcript and protein levels

      • Lineage tracing to follow the developmental fate of cells with different Ephrin-B1 expression status

    • Quantitative analysis:

      • Measurement of X-inactivation ratios using polymorphic X-linked markers

      • Single-cell RNA sequencing to identify transcriptional differences between cell populations

      • Spatial statistics to characterize the size and distribution of Ephrin-B1-expressing patches

      • Analysis of boundary regions between Ephrin-B1-positive and negative domains

    • Functional studies:

      • Cell sorting assays to assess segregation of Ephrin-B1-positive and negative cells

      • Transplantation experiments between wild-type and heterozygous tissues

      • Time-lapse imaging of cell behaviors at boundaries between different cell populations

      • Targeted ablation of specific cell populations to assess their contribution to phenotypes

    • Comparative approaches:

      • Comparison of heterozygous females with hemizygous males and homozygous mutant females

      • Analysis of different tissues to identify cell-type-specific responses to mosaic expression

      • Examination of different developmental stages to track the progression of cellular responses

      • Cross-species comparisons to identify conserved mechanisms

    Interestingly, X-inactivation in CFNS females is not markedly skewed in either blood or cranial periosteum, indicating that lack of ephrin-B1 does not compromise cell viability in these tissues .

  • What are the considerations for generating conditional Ephrin-B1 knockout models?

    Creating effective conditional Ephrin-B1 knockout models involves several key considerations:

    • Targeting strategy:

      • Design constructs with loxP sites flanking critical exons of the Efnb1 gene

      • Consider including a reporter gene to track recombination events

      • Ensure that insertion of loxP sites does not affect normal gene expression before recombination

      • Target critical functional domains to ensure complete loss of function after recombination

    • Cre driver selection:

      • Choose appropriate Cre lines based on specific research questions

      • For neural crest-specific deletion, Wnt1-Cre is commonly used

      • For broad embryonic deletion, Meox2-Cre can be employed

      • Consider temporal control using inducible Cre systems (e.g., CreERT2)

    • Background considerations:

      • Genetic background can significantly affect phenotypic outcomes

      • Mixed backgrounds show different viability rates compared to pure 129 backgrounds

      • Maintain consistent background through backcrossing if necessary

      • Include appropriate littermate controls for all experiments

    • Validation approaches:

      • Confirm deletion efficiency at both mRNA and protein levels

      • Assess potential compensatory upregulation of related ephrins

      • Evaluate both cell-autonomous and non-cell-autonomous effects

      • Compare phenotypes with germline knockout models to identify tissue-specific functions

    The table below shows the variable recovery rates of conditional Ephrin-B1 knockout mice depending on sex and genetic background :

    GenotypeBackgroundExpectedRecoveredViability (%)
    ♂ ephrin-B1 Y/lox; Meox2 Cre/+Mixed13.75858%
    ♀ ephrin-B1 +/lox; Meox2 Cre/+Mixed13.7517.2%
    ♂ ephrin-B1 Y/lox; Meox2 Cre/+12910.3219.4%
    ♀ ephrin-B1 +/lox; Meox2 Cre/+12910.3219.4%
  • What approaches are most effective for studying Ephrin-B1 mutations identified in human CFNS?

    Investigating human CFNS-associated EFNB1 mutations requires multidisciplinary approaches:

    • Molecular characterization:

      • Comprehensive mutation analysis across the entire EFNB1 gene

      • Classification of mutations into types (frameshifts, splice site mutations, nonsense, missense)

      • Structural modeling to predict effects on protein folding and function

      • Expression studies to assess effects on mRNA stability and protein levels

    • Functional analyses:

      • Creation of equivalent mutations in cell culture systems

      • Assessment of protein localization, stability, and trafficking

      • Binding assays to evaluate interaction with Eph receptors

      • Signaling assays to determine effects on forward and reverse signaling

    • Animal models:

      • Generation of knock-in mice carrying specific human mutations

      • CRISPR/Cas9-mediated introduction of mutations in model organisms

      • Comparison of phenotypes between different mutations

      • Rescue experiments to validate pathogenicity

    • Patient-derived models:

      • Derivation of induced pluripotent stem cells (iPSCs) from patient samples

      • Differentiation into relevant cell types (e.g., neural crest)

      • Organoid models of craniofacial development

      • Comparative studies between male and female patient-derived cells

    Research has identified multiple types of EFNB1 mutations in CFNS patients, including frameshift deletions, splice site mutations, nonsense mutations, and missense changes . Nine different mutations have been confirmed to arise de novo from unaffected biological parents, demonstrating their pathogenic nature conclusively .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.