Recombinant Rat Epithelial cell adhesion molecule (Epcam)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. An additional fee may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Epcam; Tacstd1; Epithelial cell adhesion molecule; Ep-CAM; Epithelial glycoprotein 314; EGP314; Protein D5.7A; Tumor-associated calcium signal transducer 1; CD antigen CD326
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-315
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVVLAVIAGIVVLVISTRKRSAKYEKAEIKEMGEIHRELNA
Uniprot No.

Target Background

Function
Epithelial cell adhesion molecule (EpCAM) acts as a homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium, contributing to the immunological barrier as a first line of defense against mucosal infection. EpCAM plays a role in embryonic stem cell proliferation and differentiation. It upregulates the expression of FABP5, MYC, and cyclins A and E.
Gene References Into Functions
  1. These results suggest that EpCAM mediates intercellular adhesion in the uterine epithelium prior to implantation. PMID: 25367431
  2. EpCAM overexpression is associated with hepatic tumors. PMID: 23098445
  3. An association between Tacstd1/EpCam and claudin-7 is noted in rat and human tumors and in non-transformed tissues of the gastrointestinal tract. PMID: 16054130
Database Links
Protein Families
EPCAM family
Subcellular Location
Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.

Q&A

What is EpCAM and what distinguishes rat EpCAM from other species?

EpCAM is a transmembrane glycoprotein expressed predominantly in epithelial tissues that functions in maintaining epithelial integrity and is involved in cell-cell adhesion. Rat EpCAM shares structural similarities with human and mouse homologs, containing an extracellular domain, a single transmembrane region, and a short cytoplasmic tail. While the extracellular domain mediates homophilic adhesion interactions, the cytoplasmic domain participates in signaling pathways.

The key functional difference in rat EpCAM lies in tissue-specific expression patterns and protein-protein interaction profiles compared to human and mouse variants. When designing experiments, researchers should consider these species-specific differences, particularly when translating findings between animal models and human disease systems. Rat EpCAM shows particularly strong expression in intestinal epithelia, where it plays important roles in maintaining barrier function through interactions with tight junction proteins .

What detection methods are most effective for recombinant rat EpCAM in experimental systems?

Multiple detection methods can be employed for identifying and quantifying recombinant rat EpCAM, with selection depending on your experimental goals:

  • Western Blotting: Most commercially available antibodies demonstrate good reactivity for rat EpCAM in Western blot applications. Polyclonal antibodies offer broader epitope recognition, while monoclonal antibodies provide higher specificity. For optimal results, use antibodies specifically validated for rat species reactivity .

  • Immunofluorescence and Immunohistochemistry: Both techniques effectively visualize EpCAM localization, with IHC-p (paraffin sections) and IHC-fr (frozen sections) giving reliable results. When examining subcellular localization, confocal microscopy with co-staining for junction proteins (claudins, occludin) provides valuable insights into EpCAM's spatial relationship with tight junctions .

  • Flow Cytometry: For measuring EpCAM expression levels in cell populations, flow cytometry using specific anti-EpCAM antibodies allows quantitative assessment and potential sorting of EpCAM-positive populations .

  • Co-immunoprecipitation: When studying protein-protein interactions involving EpCAM, co-immunoprecipitation methods have successfully identified associations with claudin-7 and claudin-1 .

For challenging experiments requiring dual detection, consider using combination approaches like immunofluorescence followed by flow cytometry or Western blotting to verify findings across methodologies.

What expression systems produce optimal yields of functional recombinant rat EpCAM?

The selection of expression system significantly impacts the quality, yield, and functionality of recombinant rat EpCAM. Several systems have demonstrated success:

Mammalian Expression Systems: HEK293 and CHO cells provide superior post-translational modifications matching native rat EpCAM. These systems accurately process glycosylation patterns critical for proper folding and function. Transient transfection using lipid-based reagents (like Lipofectamine) typically yields 1-5 mg/L, while stable selection can improve yields to 5-15 mg/L .

Retroviral Systems: For generating stable rat EpCAM expression, retroviral vectors (like pSUPER.retro.puro) have proven effective for both overexpression and knockdown studies. Phoenix-Ampho packaging cells efficiently produce retrovirus capable of transducing various epithelial cell lines including intestinal epithelial models .

Optimization Parameters: For highest functionality, consider these critical factors:

  • Culture temperature (32-37°C range affects glycosylation)

  • Media composition (serum concentration impacts yield)

  • Harvest timing (48-72 hours post-transfection typically optimal)

  • Purification strategy (affinity tags influence protein activity)

When selecting expression tags, C-terminal tags generally preserve EpCAM functionality better than N-terminal modifications, which may interfere with signal peptide processing and protein folding.

How does EpCAM regulate tight junction composition and barrier function in epithelial models?

EpCAM exerts sophisticated control over tight junction composition and barrier function through several mechanistic pathways that have been elucidated through knockdown and rescue experiments.

Claudin Protein Stability Regulation: EpCAM physically interacts with claudin-7 and indirectly with claudin-1 through claudin-7-mediated bridges. These interactions critically protect claudins from lysosomal degradation. In EpCAM knockdown experiments using shRNA in T84 and Caco-2 intestinal cell models, total cellular claudin-7 and claudin-1 protein levels decreased substantially, while transcript levels remained unchanged, indicating post-translational regulation .

Subcellular Trafficking Control: EpCAM influences the intercellular distribution of claudins. Upon EpCAM depletion, while total claudin levels decrease, their concentration specifically at tight junction structures paradoxically increases. This redistribution phenomenon suggests EpCAM normally sequesters a pool of claudins at lateral cell interfaces, maintaining them in a dynamic equilibrium with tight junction-localized populations .

Functional Barrier Consequences: EpCAM knockdown produces complex barrier phenotypes:

  • Enhanced trans-epithelial electrical resistance (TEER) acquisition

  • Increased resistance to calcium chelation-induced tight junction disruption

  • Altered paracellular ion selectivity

These findings indicate that EpCAM functions as a negative regulator of certain tight junction barrier properties, potentially by controlling claudin subtype ratios at junctional complexes.

Rescue Experiments: Re-introduction of wild-type EpCAM, but not interaction-deficient mutants (EpCAM(A279IG283I)), restores claudin protein levels, demonstrating that physical association between EpCAM and claudins is mechanistically required for their stabilization .

What are the optimal experimental approaches for studying EpCAM-claudin interactions in rat epithelial models?

Studying EpCAM-claudin interactions requires carefully designed experimental approaches to capture their dynamic and context-dependent nature:

Co-immunoprecipitation Optimization: For successful detection of native EpCAM-claudin complexes:

  • Use mild detergents (0.5-1% Triton X-100 or 1% CHAPS) that preserve membrane protein associations

  • Include protease inhibitors and perform at 4°C to minimize degradation

  • Consider crosslinking (1-2% paraformaldehyde) to stabilize transient interactions

  • Select antibodies validated for immunoprecipitation applications specifically

Proximity Ligation Assays (PLA): This technique offers superior sensitivity for detecting in situ protein-protein interactions with spatial resolution below 40nm. PLA has successfully visualized EpCAM-claudin complexes in their native membrane environment, revealing interaction hotspots along lateral membranes distinct from tight junction structures.

FRET/FLIM Analysis: For quantitative assessment of direct molecular interactions, Förster Resonance Energy Transfer combined with Fluorescence Lifetime Imaging provides distance measurements between fluorophore-tagged EpCAM and claudins. This approach has demonstrated that EpCAM-claudin-7 interactions occur at distances of approximately 5-10nm, consistent with direct binding.

Domain Mapping Strategies: Structure-function studies using truncation and point mutation constructs have identified that:

  • The transmembrane domain of EpCAM (particularly residues A279 and G283) is crucial for claudin-7 interaction

  • The C-terminal tail of claudin-7 mediates association with EpCAM

  • Claudin-1 requires claudin-7 as a molecular bridge to associate with EpCAM

When designing these experiments in rat models, consider species-specific antibody validation and control for expression level variations that might influence interaction dynamics.

How can researchers differentiate between EpCAM's adhesion versus signaling functions in experimental systems?

Distinguishing between EpCAM's adhesion and signaling functions presents a significant challenge requiring specialized experimental approaches:

Domain-Specific Mutant Analysis: Generate targeted EpCAM constructs with mutations in:

  • Extracellular domain (affecting homophilic binding but preserving signaling)

  • Cytoplasmic tail (disrupting signaling while maintaining adhesion)

  • Transmembrane domain (potentially affecting both functions)

When expressed in EpCAM-knockdown backgrounds, these constructs allow assignment of phenotypic outcomes to specific functional domains.

Temporal Inhibition Strategies: Utilize:

  • Inducible expression systems (Tet-On/Off) to control EpCAM levels with temporal precision

  • Rapid protein degradation approaches (e.g., auxin-inducible degron tags) to distinguish immediate versus delayed consequences of EpCAM removal

  • Acute antibody-mediated functional blocking versus genetic deletion to differentiate between scaffolding and active signaling roles

Binding Partner Manipulation: Selective disruption of EpCAM interactions through:

  • siRNA knockdown of specific downstream signaling mediators

  • Peptide inhibitors targeting defined interaction interfaces

  • CRISPR-mediated mutation of binding sites on partner proteins

Adhesion versus Signaling Readouts:

FunctionMeasurement TechniquesTypical TimeframeControls
AdhesionCell aggregation assays, Atomic force microscopy, Cell detachment assaysMinutes to hoursE-cadherin blocking, Ca²⁺ chelation
SignalingPhosphorylation assays, Transcriptional reporter assays, ProteomicsSeconds to daysPathway inhibitors, Signal-dead mutants

In rat epithelial models, distinguish these functions by combining acute EpCAM neutralization (addressing adhesion) with stable expression of signaling-deficient mutants (isolating adhesion components). This approach has revealed that EpCAM's effects on tight junction proteins primarily reflect its scaffold/stabilization functions rather than active signaling.

What advanced imaging techniques best characterize EpCAM trafficking and degradation pathways?

EpCAM undergoes complex trafficking processes that impact its function and stability. Several advanced imaging approaches have proven particularly valuable:

Live-Cell Confocal Microscopy with Photoactivatable Fluorophores: This technique enables pulse-chase visualization of EpCAM cohorts from synthesis through degradation. Using constructs like EpCAM-PA-GFP (photoactivatable green fluorescent protein), researchers can selectively illuminate pools of EpCAM at specific cellular locations and track their fate with sub-minute temporal resolution .

Super-Resolution Microscopy Approaches:

  • STORM (Stochastic Optical Reconstruction Microscopy) achieves ~20nm resolution, revealing EpCAM nanoclusters at lateral membranes

  • STED (Stimulated Emission Depletion) microscopy can visualize dynamic interactions between EpCAM and endocytic machinery

  • Lattice light-sheet microscopy offers extended imaging durations with minimal phototoxicity for tracking EpCAM trafficking over hours

Correlative Lysosomal Tracking:
Simultaneous visualization of EpCAM with lysosomal markers (LAMP1) using dual-color imaging has demonstrated that:

  • Claudin-7 and claudin-1 continuously traffic into lysosomes in the absence of EpCAM

  • EpCAM prevents this degradation through direct physical interaction

  • Lysosomal inhibitors (chloroquine, bafilomycin A1) rescue claudin levels in EpCAM-depleted cells

Fluorescence Recovery After Photobleaching (FRAP): This technique quantifies EpCAM membrane dynamics, revealing:

  • Lateral diffusion rates within membranes

  • Exchange rates between membrane and intracellular pools

  • Immobile fractions indicating stable protein complexes

For optimal results in rat epithelial models, combine these approaches with quantitative image analysis using specialized software (ImageJ with TrackMate, Imaris) to extract kinetic parameters of trafficking and degradation.

How do post-translational modifications affect rat EpCAM function in cell adhesion and signaling?

Post-translational modifications (PTMs) critically regulate rat EpCAM's multiple functions through dynamic and often interdependent mechanisms:

N-Glycosylation Profiles:
Rat EpCAM contains three N-glycosylation sites (Asn74, Asn111, Asn198) that influence:

  • Protein folding and stability

  • Cell surface presentation

  • Homophilic binding capacity

  • Resistance to proteolytic processing

Experimental approaches to study glycosylation effects include site-directed mutagenesis of glycosylation sites, enzymatic deglycosylation (PNGase F, Endo H), and glycoform-specific antibodies. Notably, differential glycosylation patterns between normal and tumor-derived EpCAM have been observed, suggesting context-dependent regulation.

Proteolytic Processing:
Rat EpCAM undergoes regulated intramembrane proteolysis (RIP) involving:

  • ADAM (A Disintegrin And Metalloprotease) family proteases that cleave the extracellular domain

  • γ-secretase complex that subsequently releases the intracellular domain (EpICD)

This processing directly affects EpCAM's signaling capabilities, as EpICD translocates to the nucleus and influences gene transcription. Detection methods include Western blotting with domain-specific antibodies and reporter systems tracking EpICD nuclear translocation.

Ubiquitination and Protein Stability:
EpCAM undergoes K48- and K63-linked ubiquitination, which regulates:

  • Protein half-life (typically 18-24 hours)

  • Lysosomal versus proteasomal degradation routing

  • Interaction capability with claudins and other binding partners

Experimental approaches include immunoprecipitation with anti-ubiquitin antibodies, proteasome inhibitors (MG132), and expression of ubiquitin mutants. Notably, claudin-associated EpCAM shows reduced ubiquitination compared to non-complexed EpCAM, suggesting that protein-protein interactions protect against degradation .

Phosphorylation Events:
Several serine/threonine phosphorylation sites in rat EpCAM's cytoplasmic domain influence:

  • Protein-protein interaction affinities

  • Subcellular localization signals

  • Susceptibility to proteolytic processing

Mass spectrometry approaches have identified context-dependent phosphorylation patterns that correlate with epithelial differentiation states.

What are the optimal in vitro models for studying recombinant rat EpCAM in barrier function research?

Selecting appropriate experimental models is crucial for studying rat EpCAM's role in epithelial barrier function:

Intestinal Epithelial Cell Models:
T84 and Caco-2 cell lines have proven particularly valuable for EpCAM research due to their:

  • Ability to form polarized monolayers with functional tight junctions

  • Expression of endogenous EpCAM and claudins in physiological ratios

  • Capacity to generate measurable trans-epithelial electrical resistance (TEER)

  • Responsiveness to EpCAM manipulation via knockdown and overexpression

Primary Rat Epithelial Culture Systems:
For higher physiological relevance, consider:

  • Primary rat intestinal epithelial cell (IEC) cultures

  • Air-liquid interface cultures of respiratory epithelia

  • 3D organoid models derived from rat intestinal stem cells

These systems maintain tissue-specific microenvironments and cell-cell interactions absent in immortalized lines.

Transwell-Based Barrier Function Assays:
To quantitatively assess EpCAM's impact on barrier properties:

  • Culture cells on permeable supports (0.4μm pore size) until confluence

  • Measure TEER development over time (typically 7-21 days)

  • Assess paracellular permeability using size-selective tracers (FITC-dextrans of varying molecular weights)

  • Challenge barrier integrity with calcium chelation (EGTA) to assess junctional stability

Calcium Switch Assays:
This technique provides valuable insights into junction assembly dynamics:

  • Deplete extracellular calcium to disrupt cell-cell contacts

  • Restore normal calcium levels and monitor junction reassembly

  • Track TEER recovery rates and junction protein relocalization

  • Compare EpCAM-normal versus EpCAM-deficient conditions

EpCAM knockdown cells show increased resistance to calcium chelation-induced tight junction disruption, suggesting enhanced junctional stability .

What controls are essential when studying EpCAM-dependent protein-protein interactions?

Rigorous controls are crucial for ensuring reliable and interpretable results when investigating EpCAM's protein-protein interactions:

Expression Level Controls:

  • Match expression levels between wild-type and mutant constructs to avoid artifacts from overexpression

  • Use inducible expression systems to titrate protein levels

  • Quantify absolute protein concentrations via calibrated Western blotting

Subcellular Localization Controls:

  • Confirm membrane localization of recombinant EpCAM constructs

  • Verify that tags or mutations don't alter trafficking or localization

  • Include plasma membrane markers (Na/K-ATPase) and junction markers (ZO-1)

Antibody Validation Controls:

  • Confirm antibody specificity using EpCAM-knockout samples

  • Test multiple antibodies recognizing different epitopes

  • Include isotype controls for immunoprecipitation

  • Validate species cross-reactivity for rat EpCAM detection

Interaction Specificity Controls:

  • Include non-interacting membrane proteins (CD26) as negative controls

  • Test known binding partners (claudin-7) as positive controls

  • Compare structurally related but non-interacting proteins (claudin-2, claudin-4)

  • Perform reverse immunoprecipitations to confirm bidirectional pull-down

Functional Validation Approaches:

  • Rescue experiments with wild-type versus interaction-deficient mutants

  • Domain mapping to identify critical interaction regions

  • Competition assays with peptides derived from interaction interfaces

  • Correlation of binding with functional outcomes (claudin stability, barrier function)

The table below summarizes essential controls for common interaction detection methods:

MethodPositive ControlNegative ControlTechnical Control
Co-IPKnown interactor (claudin-7)Non-interactor (CD26)IgG isotype control
Proximity LigationEstablished protein pairsProteins in distinct compartmentsPrimary antibody omission
FRETFusion constructs with fixed distancesNon-interacting pairsAcceptor photobleaching
Mass SpectrometrySpiked-in known partnersIgG pulldownsReverse SILAC labeling

How should researchers approach contradictory findings in EpCAM functional studies?

Researchers frequently encounter seemingly contradictory findings in EpCAM studies, requiring systematic approaches to resolve discrepancies:

Context-Dependent Function Analysis:
EpCAM exhibits different functions depending on cellular context. When encountering contradictory findings, systematically evaluate:

  • Cell type differences (epithelial subtypes, cancer vs. normal)

  • Species-specific variations (human vs. rat EpCAM)

  • Developmental stage (embryonic vs. adult expression patterns)

  • Disease state (normal tissue vs. inflammatory or neoplastic conditions)

Expression Level Considerations:
EpCAM's effects are often concentration-dependent. Contradictory findings may reflect:

  • Overexpression artifacts versus physiological expression

  • Complete knockout versus partial knockdown phenotypes

  • Acute versus chronic depletion consequences

  • Compensatory mechanisms activated in stable depletion models

Technical Reconciliation Strategies:

  • Standardize experimental platforms: Use identical cell systems, culture conditions, and detection methods when directly comparing results

  • Employ multiple methodologies: Validate findings across techniques (genetic manipulation, antibody blocking, dominant-negative approaches)

  • Control temporal variables: Distinguish between immediate versus adaptive responses through time-course experiments

  • Quantitative analysis: Apply statistical approaches to determine if contradictions reflect genuine biological variability versus technical artifacts

Integrative Interpretation Framework:
When analyzing contradictory findings about EpCAM's role in tight junctions:

  • EpCAM knockdown decreases total claudin-7 and claudin-1 levels while increasing their concentration specifically at tight junctions

  • This apparent contradiction is resolved by recognizing EpCAM's dual role as both a stabilizer of total claudin pools and a regulator of their subcellular distribution

  • EpCAM may sequester claudins away from tight junctions while simultaneously protecting them from lysosomal degradation

When publishing results that contradict existing literature, include detailed methodological comparisons and attempt to replicate previously published conditions to identify specific variables driving the discrepancies.

What are the critical parameters for successful expression and purification of functional recombinant rat EpCAM?

Producing high-quality recombinant rat EpCAM requires careful optimization of expression and purification parameters:

Expression System Selection:
For full-length membrane-bound rat EpCAM:

  • Mammalian systems (HEK293, CHO) provide appropriate post-translational modifications

  • Insect cell systems (Sf9, High Five) offer good compromise between yield and modification

  • Avoid prokaryotic systems which fail to properly fold and glycosylate EpCAM

For soluble EpCAM ectodomains:

  • Fusion with IgG-Fc enhances solubility and facilitates purification

  • Inclusion of natural signal peptides improves secretion efficiency

  • Codon optimization for expression host increases yield

Critical Expression Parameters:

  • Temperature: Lowering to 30-32°C often improves folding of membrane proteins

  • Induction timing: For inducible systems, induce at mid-log phase for optimal balance of cell density and viability

  • Media supplements: Addition of glycosylation precursors and chaperone inducers enhances functional yield

  • Harvest timing: 48-72 hours post-induction typically provides optimal balance between yield and quality

Purification Strategy Optimization:
For transmembrane EpCAM:

  • Efficient membrane extraction using mild detergents (DDM, CHAPS)

  • Affinity chromatography using tag-based or antibody-based capture

  • Size exclusion chromatography to remove aggregates and ensure monodispersity

For secreted EpCAM ectodomains:

  • Concentration of culture supernatant using tangential flow filtration

  • Protein A/G affinity chromatography for Fc-fusion proteins

  • Ion exchange chromatography to remove contaminants

  • Buffer exchange to remove elution agents that may affect functionality

Quality Control Assessments:

  • SDS-PAGE and Western blotting to confirm size and immunoreactivity

  • Glycosylation analysis using PNGase F digestion and lectin binding

  • Dynamic light scattering to assess aggregation state

  • Functional binding assays (e.g., claudin interaction studies)

Researchers encountering low yields should systematically optimize each parameter through Design of Experiments (DoE) approaches rather than one-factor-at-a-time optimization.

How can researchers overcome common challenges in EpCAM knockdown and overexpression experiments?

EpCAM manipulation experiments present several technical challenges that can be addressed through optimized approaches:

Knockdown Efficiency Optimization:
For shRNA-based approaches:

  • Test multiple targeting sequences (minimum 3-4 distinct targets)

  • Use retroviral or lentiviral delivery for stable integration

  • Implement puromycin selection for uniform knockdown population

  • Consider clonal selection to achieve consistent knockdown levels

For CRISPR/Cas9 knockout strategies:

  • Design sgRNAs targeting early exons to ensure complete functional disruption

  • Screen multiple clones to identify complete knockouts

  • Verify knockout at both protein and genomic levels

  • Be aware that complete EpCAM knockout may be lethal in some epithelial models

Overcoming Cellular Compensation:

  • Use inducible systems (Tet-On/Off) to minimize adaptive responses

  • Perform time-course analyses to distinguish immediate versus compensatory effects

  • Consider acute approaches (CRISPRi) for temporary knockdown

  • Monitor expression of related family members (epithelial adhesion molecules) that might compensate

Phenotype Verification Strategies:

  • Rescue experiments with wild-type rat EpCAM to confirm specificity

  • Use multiple siRNA/shRNA sequences targeting different regions

  • Include non-targeting controls with similar delivery methods

  • Quantify knockdown/overexpression levels in each experiment

Common Technical Issues and Solutions:

ChallengeUnderlying CauseSolution
Poor knockdown efficiencySecondary structure in target regionTest multiple target sequences
Cellular toxicityOff-target effectsUse validated shRNA sequences with minimal off-target potential
Inconsistent phenotypesHeterogeneous knockdown populationPerform clonal selection and validate EpCAM levels in each clone
Failed rescue experimentsInsufficient expression of rescue constructUse expression systems with different promoters than knockdown vectors
Altered cell morphologyEpCAM's role in cytoskeletal organizationDocument morphological changes quantitatively as part of phenotype

When generating stable T84 or Caco-2 cell lines with EpCAM manipulation, researchers should anticipate altered adhesiveness and morphology as intrinsic consequences of EpCAM modulation rather than technical artifacts .

What methodological approaches best elucidate EpCAM's role in lysosomal trafficking and protein degradation?

Investigating EpCAM's role in preventing claudin degradation requires sophisticated methodological approaches:

Protein Turnover Measurement:

  • Pulse-chase experiments using metabolic labeling (35S-methionine/cysteine)

  • Cycloheximide chase assays to block new protein synthesis

  • SNAP/CLIP-tag labeling for temporal cohort tracking

  • Quantification of half-life differences between EpCAM-positive and EpCAM-depleted conditions

Lysosomal Pathway Investigation:

  • Pharmacological inhibitors: Bafilomycin A1 (V-ATPase inhibitor), Chloroquine (lysosomal pH disruptor)

  • Lysosomal visualization: LysoTracker probes, LAMP1 immunostaining

  • Co-localization analysis: Calculate Pearson/Manders coefficients between claudins and lysosomal markers

  • Live-cell imaging: Track claudin-fluorescent protein fusions during trafficking to lysosomes

Ubiquitination Analysis:

  • Immunoprecipitation under denaturing conditions to preserve ubiquitin modifications

  • Western blotting with linkage-specific ubiquitin antibodies (K48 vs. K63)

  • Mass spectrometry to identify ubiquitination sites on claudins

  • Ubiquitin mutant expression to distinguish degradative versus regulatory ubiquitination

Advanced Trafficking Assays:

  • Surface biotinylation with internalization tracking

  • Reversible biotinylation to distinguish recycling from degradation

  • Quantum dot labeling of surface proteins for single-molecule tracking

  • Correlative light-electron microscopy to visualize ultrastructural localization

Experimental Workflow for EpCAM-Dependent Degradation Studies:

  • Generate paired cell lines (EpCAM-normal and EpCAM-depleted)

  • Treat with cycloheximide to block new protein synthesis

  • Collect time points (0-24h) for Western blot analysis of claudin levels

  • In parallel experiments, add lysosomal inhibitors to block degradation

  • Confirm lysosomal targeting through immunofluorescence co-localization

  • Quantify protein half-lives under different conditions

This approach has successfully demonstrated that claudin-7 and claudin-1 continually traffic to lysosomes in the absence of EpCAM protection, with their stability dependent on direct physical interaction with EpCAM .

What emerging technologies hold promise for advancing rat EpCAM functional studies?

Several cutting-edge technologies are poised to significantly advance our understanding of rat EpCAM biology:

CryoEM for Structural Analysis:
Recent advances in cryogenic electron microscopy now enable structural determination of membrane protein complexes in near-native environments. For EpCAM research, this technology offers:

  • Visualization of EpCAM-claudin complexes at near-atomic resolution

  • Structural insights into the transmembrane interfaces critical for interaction

  • Conformational dynamics information through particle classification

  • Validation of interaction models previously inferred from mutation studies

Genome-Wide CRISPR Screens:
Unbiased genetic screens can identify novel regulators and effectors of EpCAM function:

  • CRISPR activation/interference libraries to identify modulators of EpCAM-dependent phenotypes

  • Synthetic lethality screens in EpCAM-deficient backgrounds

  • Chemical-genetic interaction mapping to discover pathway connections

  • Parallel screens across multiple epithelial cell types to identify context-specific factors

Organoid and Tissue-on-Chip Technologies:
These physiologically relevant models offer advantages over traditional cell culture:

  • Intestinal organoids from rat stem cells recapitulate tissue architecture

  • Microfluidic organ-on-chip devices allow controlled manipulation of mechanical forces

  • Co-culture systems incorporating immune and stromal components

  • Real-time barrier function assessment in complex tissue environments

Single-Cell Multi-omics:
Integration of transcriptomic, proteomic, and functional data at single-cell resolution:

  • Single-cell RNA-seq to identify cell populations differentially affected by EpCAM manipulation

  • Single-cell proteomics to quantify claudin levels and modifications

  • Spatial transcriptomics to map expression patterns within tissue contexts

  • Multi-modal data integration to build predictive models of EpCAM function

Optogenetic and Chemogenetic Control:
Precise temporal control over EpCAM function:

  • Photocleavable protein protection to trigger rapid EpCAM degradation

  • Optogenetic clustering to modulate EpCAM oligomerization state

  • Light-controlled protein-protein interaction systems to manipulate EpCAM-claudin associations

  • Chemical-induced dimerization to force or disrupt specific protein complexes

These technologies will enable researchers to address previously intractable questions about the dynamic regulation and context-specificity of EpCAM functions in epithelial biology.

What are the critical unanswered questions regarding EpCAM's dual roles in normal physiology versus disease states?

Despite significant progress in understanding EpCAM biology, several critical questions remain unresolved, particularly regarding its context-dependent functions:

Molecular Switching Mechanisms:

  • What molecular mechanisms determine whether EpCAM primarily functions in adhesion versus signaling?

  • How do post-translational modifications regulate this functional duality?

  • Are there tissue-specific cofactors that dictate predominant functional modes?

  • How do mechanical forces and tissue architecture influence EpCAM's functional state?

Developmental Regulation:

  • How are EpCAM expression and function dynamically regulated during epithelial development?

  • What transcriptional programs control tissue-specific EpCAM expression patterns?

  • How does EpCAM contribute to epithelial morphogenesis and barrier establishment?

  • Are there developmental windows where EpCAM function is particularly critical?

Pathophysiological Transitions:

  • How does EpCAM's function shift during progression from normal epithelium to carcinoma?

  • What mechanisms explain EpCAM's apparently contradictory roles in maintaining epithelial integrity versus promoting tumor progression?

  • How do inflammatory conditions alter EpCAM's interactions with tight junction proteins?

  • Can targeted modulation of EpCAM function restore normal barrier properties in disease states?

Junction Regulatory Networks:

  • How does EpCAM integrate into the broader regulatory network controlling junctional complexes?

  • What are the functional consequences of altered claudin composition at tight junctions in EpCAM-deficient states?

  • How do EpCAM-claudin interactions influence other junctional components (occludin, ZO proteins)?

  • What signaling pathways mediate communication between EpCAM and tight junction complexes?

Addressing these questions will require integrative approaches combining structural biology, dynamic imaging, and sophisticated genetic manipulation in physiologically relevant models. Particular emphasis should be placed on understanding the molecular mechanisms that determine context-specific functions, as these may represent potential therapeutic targets in diseases involving epithelial barrier dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.