Recombinant Rat Fatty acid desaturase 1 (Fads1)
Description
Fundamental Characteristics of Fatty Acid Desaturase 1
Fatty Acid Desaturase 1 (Fads1), also designated as delta-5 desaturase (D5D), constitutes a critical enzymatic component in the biosynthesis of highly unsaturated fatty acids (HUFAs) . This membrane-bound enzyme introduces specific double bonds between defined carbon atoms in fatty acyl chains, thereby regulating the unsaturation level of fatty acids . Rat Fads1, identified with the gene ID 84575, shares considerable structural and functional similarities with its orthologs across various mammalian species .
The architectural composition of Fads1 represents a fusion product featuring an N-terminal cytochrome b5-like domain coupled with a C-terminal multiple membrane-spanning desaturase portion . Both domains exhibit characteristically conserved histidine motifs that play pivotal roles in the enzyme's catalytic functioning . This distinctive arrangement facilitates the protein's membrane localization and its specific desaturase activity within the endoplasmic reticulum (ER) .
Rat Fads1 protein encompasses 447 amino acids, as determined by sequence analyses, with a molecular mass approximating 52.0 kDa . The protein sequence reveals a complex organization of transmembrane domains interspersed with functional motifs essential for substrate recognition and catalytic activity. The comprehensive amino acid sequence, as reported in database entries, starts with "MAPDPVQTPDPASAQLRQMRYFTWEEVAQRSGREKERWLVIDRKVYNISDFSRRHPGGSR" and continues through its entirety, establishing the structural foundation for its functional capabilities .
Genomic Organization and Evolutionary Context
Fads1 exists within a gene cluster alongside related desaturases, notably Fads2 and Fads3 . This clustering pattern appears conserved across various mammalian species, suggesting significant evolutionary pressure to maintain this genomic arrangement . The gene spans approximately 17.2 kb of genomic DNA and shares 61% and 52% sequence identity with Fads2 and Fads3 respectively, indicating their common evolutionary origin .
Evidence strongly suggests that the Fads gene family arose through evolutionary gene duplication events, resulting in three closely related genes with similar exon/intron organization but divergent substrate specificities and biological functions . This evolutionary relationship explains the structural similarities while accounting for their functional specialization within lipid metabolism pathways.
Production and Characterization of Recombinant Rat Fads1
Recombinant Rat Fads1 protein is predominantly produced using prokaryotic expression systems, with Escherichia coli serving as the predominant host organism . This production methodology enables the generation of substantial quantities of functional protein for research applications while maintaining structural fidelity to the native enzyme. The recombinant protein typically incorporates affinity tags—most commonly histidine (His) tags—to facilitate purification through affinity chromatography techniques .
Commercial preparations of Recombinant Rat Fads1 exhibit high purity levels, frequently exceeding 97% as determined by SDS-PAGE and Western blotting analyses . These preparations commonly utilize optimized buffer systems incorporating Tris-based formulations with 50% glycerol to maintain protein stability during storage . Standard protocols recommend storage at -20°C for short-term use, with -80°C recommended for extended preservation periods to prevent degradation and loss of enzymatic activity .
Quality Control Parameters
Commercial Recombinant Rat Fads1 preparations undergo rigorous quality control procedures to ensure consistency and functionality . These procedures typically include SDS-PAGE for purity assessment, Western blotting for identity confirmation, and occasionally activity assays to verify enzymatic functionality . Manufacturers recommend specific working dilutions for various applications, with optimization advised based on experimental conditions and requirements .
Storage stability constitutes a critical parameter for maintaining recombinant protein functionality, with recommendations against repeated freeze-thaw cycles to preserve structural integrity and enzymatic activity . Most commercial preparations incorporate stabilizing agents such as glycerol and specify optimal temperature conditions for both short-term and long-term storage to maximize shelf life .
Functional Characteristics and Metabolic Significance
Fads1 plays a crucial role in the biosynthesis pathway of long-chain polyunsaturated fatty acids (LCPUFAs), specifically functioning as a delta-5 desaturase in the endogenous synthesis of arachidonic acid (AA; 20:4n-6) and eicosapentaenoic acid (EPA; 20:5n-3) . The enzyme catalyzes the conversion of dihomo-γ-linolenic acid (DGLA; 20:3n-6) to arachidonic acid and eicosatetraenoic acid (ETA; 20:4n-3) to eicosapentaenoic acid through the introduction of a double bond at the delta-5 position .
This enzymatic activity positions Fads1 as a critical regulator in eicosanoid production pathways, with significant implications for inflammatory responses, cell signaling, and various physiological processes . The products of Fads1 activity, particularly arachidonic acid, serve as precursors for biologically active lipid mediators including prostaglandins, thromboxanes, and leukotrienes .
Metabolic Integration and Cellular Function
Recent investigations have revealed that Fads1, in conjunction with Fads2, contributes to NAD recycling for glycolysis, supporting cellular viability under conditions of suppressed aerobic respiration . This function represents an additional role beyond its canonical involvement in fatty acid metabolism, highlighting the enzyme's multifaceted contribution to cellular metabolic networks.
The expression pattern of Fads1 exhibits tissue specificity, with high expression levels documented in liver, brain, and heart tissues . This distribution pattern correlates with the significant LCPUFA requirements of these metabolically active organs, underscoring the enzyme's importance in maintaining tissue-specific lipid compositions essential for proper physiological functioning.
Isoform Diversity and Functional Implications
Research has identified alternative transcripts of Fads1, including a variant designated Fads1AT1, which appears to enhance Fads2 activity without directly exerting desaturase activity itself . This discovery represents the first documented case of an isoform modulating the enzymatic activity encoded by a different gene within the same family, suggesting sophisticated regulatory mechanisms governing LCPUFA biosynthesis .
The classic Fads1 protein localizes to both the endoplasmic reticulum and mitochondria, while the Fads1AT1 isoform exhibits distinct localization patterns, indicating potential organelle-specific functions . This differential localization may contribute to the regulation of fatty acid desaturation in a manner specific to cellular compartments, developmental stages, or physiological conditions.
Research Applications and Experimental Utility
Recombinant Rat Fads1 finds extensive application in various research methodologies, including Western blotting (WB), SDS-PAGE, immunological assays, and protein characterization studies . The availability of high-purity recombinant preparations facilitates detailed investigations into enzyme structure-function relationships, substrate specificity determinations, and inhibitor screening applications.
Enzyme activity assays utilizing recombinant Fads1 enable quantitative assessment of desaturase function under controlled experimental conditions, providing valuable insights into the catalytic mechanisms and regulatory factors influencing enzymatic efficiency . These assays frequently employ gas chromatography or liquid chromatography coupled with mass spectrometry to monitor the conversion of substrate fatty acids to their desaturated products.
Physiological and Pathological Investigations
Recombinant Fads1 serves as a crucial tool in research examining the relationship between fatty acid metabolism and various physiological and pathological conditions . Studies have implicated Fads1 in metabolic disorders, inflammatory conditions, and certain cancers, highlighting its potential significance as both a biomarker and therapeutic target .
Recent investigations have demonstrated connections between Fads1 expression levels and ferroptosis sensitivity in certain cancer cell types, particularly in mesenchymal-type gastric cancer cells . This relationship suggests potential applications for Fads1-targeted approaches in cancer therapy, specifically through modulation of ferroptotic cell death pathways.
Comparative Studies and Evolutionary Analysis
The availability of recombinant Fads1 from rat sources facilitates comparative studies with orthologs from other species, including human, mouse, and various other mammals . Such comparative analyses provide valuable insights into the evolutionary conservation of desaturase functions across species and the adaptation of fatty acid metabolism to diverse physiological requirements and dietary patterns.
Cross-species comparisons have revealed significant conservation of Fads1 structure and function, with variations in substrate preferences and catalytic efficiencies potentially reflecting species-specific adaptations in lipid metabolism . These evolutionary insights contribute to our understanding of the fundamental roles of desaturases in maintaining cellular membrane integrity and producing signaling molecules across diverse taxonomic groups.
Future Research Directions and Technological Developments
The continued refinement of recombinant protein production methodologies promises to enhance the availability and quality of Recombinant Rat Fads1 for research applications. Advances in expression systems, purification techniques, and protein engineering approaches may yield preparations with improved stability, activity, and specificity characteristics tailored to specific experimental requirements.
Structural biology investigations, including X-ray crystallography and cryo-electron microscopy studies, represent critical future directions for elucidating the three-dimensional structure of Fads1 at atomic resolution. Such structural insights would significantly advance our understanding of the catalytic mechanism, substrate recognition determinants, and potential inhibitor binding sites, facilitating rational drug design approaches targeting Fads1 activity.
Therapeutic Potential and Translational Applications
The emerging connections between Fads1 activity and various pathological conditions suggest potential translational applications for Fads1-targeted therapeutic strategies . Modulation of Fads1 expression or activity could potentially influence eicosanoid production profiles, impacting inflammatory responses, cancer progression, and metabolic function in clinically relevant contexts.
Development of specific inhibitors or activators targeting Rat Fads1 may provide valuable research tools for investigating the physiological consequences of altered desaturase activity in animal models. Such compounds could potentially serve as leads for therapeutic development, particularly in conditions characterized by dysregulated fatty acid metabolism or abnormal inflammatory responses.
Product Specs
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will then prepare the product according to your request.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
- Regulation of 5-desaturase expression differs in female versus male liver (but not cerebral cortex) during n-3 fatty acid repletion. PMID: 19157821
- These findings support a significant role for reverse Delta5-desaturase as a natural antisense regulator of Delta5-desaturase. PMID: 16846730
Q&A
What is the function of Fads1 in fatty acid metabolism?
Fads1 (Fatty Acid Desaturase 1) is a key enzyme that introduces a double bond at specific positions in the carbon chain of fatty acids. It primarily catalyzes the conversion of dihomo-gamma-linolenic acid (DGLA, C20:3n6) to arachidonic acid (AA, C20:4n6) . This desaturation step is crucial in the biosynthesis pathway of polyunsaturated fatty acids (PUFAs). The AA/DGLA ratio is commonly used as an indicator of Fads1 activity in research settings . Additionally, Fads1 plays a role in the synthesis of docosahexaenoic acid (DHA), another important PUFA with various physiological functions . The enzyme's activity influences the balance of inflammatory and anti-inflammatory fatty acid derivatives, thereby affecting numerous cellular processes.
How is recombinant rat Fads1 typically cloned and expressed?
Recombinant rat Fads1 is commonly cloned by amplifying the full-length coding sequence using PCR with specific primers containing appropriate restriction sites. The amplified product (approximately 1350-bp) is then cloned into expression vectors such as pCMV/myc/cyto, and the correct in-frame orientation is confirmed through DNA sequencing . For expression, these recombinant plasmids are transiently transfected into mammalian cell lines such as Cos-7 cells, typically using electroporation methods (e.g., 250V-1500μF) . Following transfection, cells are cultured in appropriate media (such as DMEM with 10% FCS) for about 48 hours before harvesting for protein extraction . Transfection efficiency can be assessed through co-transfection with reporter genes like β-galactosidase and subsequent colorimetric assays .
What are the common methods to verify successful expression of recombinant Fads1?
Several complementary approaches are used to verify successful expression of recombinant rat Fads1:
-
Western blotting: Using specific antibodies against Fads1 or epitope tags (such as myc) included in the expression construct. Multiple antibodies targeting different regions of the protein (e.g., N-terminal and C-terminal specific antibodies) may be used for confirmation .
-
Activity assays: Measuring the conversion of substrate (DGLA) to product (AA) using gas chromatography or other analytical techniques. The AA/DGLA ratio serves as a functional verification of Fads1 activity .
-
qRT-PCR: Quantifying Fads1 mRNA expression to confirm transcriptional upregulation .
-
Immunocytochemistry: Visualizing the subcellular localization of the expressed protein using specific antibodies.
For viral vector-mediated expression (such as AAV8), verification also includes detection of viral sequences like inverted terminal repeats (ITRs) in the target tissue using quantitative PCR .
How does hepatocyte-specific Fads1 overexpression affect metabolic phenotypes?
Recent research has demonstrated that hepatocyte-specific overexpression of Fads1 using AAV8 vectors produces significant metabolic benefits in rodent models fed Western diets. Studies show that Fads1 overexpression in hepatocytes results in:
-
Increased hepatic levels of arachidonic acid (AA) and docosahexaenoic acid (DHA) in free fatty acid (FFA) pools .
-
Attenuation of Western diet-induced metabolic abnormalities and non-alcoholic fatty liver disease (NAFLD, now termed MASLD) .
-
Rescue of hepatic Fads1 activity (measured by the AA/DGLA ratio) that was markedly reduced by high-fat, high-fructose (HFHFr) diets .
These findings suggest that Fads1 represents a viable target for the treatment of metabolic disorders in preclinical models . The mechanisms likely involve improved PUFA metabolism, which influences inflammatory pathways and metabolic signaling. The data indicate that altering the balance of fatty acids through Fads1 modulation can have systemic effects on metabolic health, providing potential therapeutic avenues for conditions like NAFLD/MASLD.
What role does Fads1 play in cancer progression?
Research has uncovered that Fads1 can function as an oncogene in certain cancers, particularly laryngeal squamous cell carcinoma (LSCC). Studies utilizing both in vitro and in vivo approaches have demonstrated that:
-
Fads1 is upregulated in LSCC tissues compared to normal tissues, as identified through microarray analysis .
-
Fads1 variation is significantly associated with laryngeal cancer risk according to genome-wide association studies (GWAS) .
-
Fads1 promotes cancer progression through activation of the AKT/mTOR signaling pathway, a key regulator of cell growth and proliferation .
The oncogenic properties of Fads1 have been validated through both overexpression and knockdown experiments using lentiviral vectors. Specifically, the lentiviral vector system encoding the full-length Fads1 sequence (GV492-gcGFP-FADS1) was used for overexpression studies, while shRNA vectors (FADS1-shRNA1/2/3) were employed for knockdown experiments . These findings suggest that targeting Fads1 or its downstream pathways may represent a novel therapeutic strategy for LSCC and potentially other cancers where PUFA metabolism plays a significant role.
Is there a causal relationship between Fads1 expression in specific brain tissues and cognitive function?
Mendelian randomization (MR) studies have investigated the potential causal relationship between Fads1 expression in brain tissues and cognitive function. Key findings include:
-
Research has examined Fads1 expression in multiple brain tissues (10 brain tissues according to GTEx data and 3 brain tissues using MetaBrain data) and its relationship to cognitive function .
-
The Wald ratio method has been applied to estimate the causal effects, using cis-eQTLs (expression quantitative trait loci) as genetic instruments .
-
Statistical rigor has been ensured through multiple testing corrections using the Benjamini-Hochberg method for false discovery rate (FDR) .
-
Bayesian colocalization methods (COLOC) have been employed to examine the probability of shared causal variants between Fads1 expression and cognitive function, with a colocalization probability (PP.H4) > 70% suggesting shared causal variants .
-
Linkage disequilibrium checks have been performed to assess approximate colocalization, with r² > 0.7 between cis-eQTLs and cognitive function variants considered as evidence of colocalization .
These studies suggest potential tissue-specific and cell type-specific effects of Fads1 on cognitive outcomes, though caution is warranted for some analyses due to potential weak instrument bias (F statistics < 10) in certain tissues like the hippocampus and substantia nigra .
How does N-myristoylation affect the localization and activity of desaturases?
While not specifically focused on Fads1, research on dihydroceramide Δ4-desaturase 1 (DES1) provides valuable insights into how post-translational modifications like N-myristoylation can affect desaturase enzymes:
-
N-myristoylation significantly increases the activity of recombinant DES1 in cell models .
-
This modification affects subcellular localization: the wild-type myristoylable form of rat DES1 is found in both the endoplasmic reticulum and mitochondria, whereas the non-myristoylable mutant (with N-terminal glycine replaced by alanine) is almost exclusively localized to the endoplasmic reticulum .
-
Among various fatty acids tested, myristic acid specifically increases native DES1 activity in both total cell lysates and mitochondrial fractions .
-
The increase in activity is not linked to elevated mRNA or protein expression but rather to the N-terminal myristoylation itself .
-
The enhanced DES1 activity due to myristic acid slightly increases apoptotic cell numbers, suggesting functional consequences of this modification .
These findings have potential implications for Fads1 and other desaturases, suggesting that post-translational modifications might be important regulators of their localization, activity, and biological effects.
What are the recommended techniques for assessing Fads1 activity in tissue samples?
Assessing Fads1 activity in tissue samples typically involves measuring the product-to-precursor ratio of fatty acids as a surrogate for enzyme activity. The recommended techniques include:
-
Fatty acid profiling: Tissue samples (e.g., 5 μL liver extracts) are dissolved in methanolic HCl (2N), heated at 70-80°C for 4 hours, cooled, and dried under nitrogen. The samples are then reconstituted in dichloromethane for analysis . Gas chromatography with flame ionization detection (GC-FID) or gas chromatography-mass spectrometry (GC-MS) is used to separate and quantify fatty acids.
-
Calculation of desaturation indices: The AA/DGLA ratio is the primary indicator of Fads1 activity . This can be calculated from the quantified fatty acid data.
-
Lipidomics analysis: More comprehensive lipidomic approaches can provide detailed fatty acid profiles across different lipid classes (phospholipids, free fatty acids, triglycerides, etc.) .
-
Expression analysis: qRT-PCR for Fads1 mRNA expression and Western blotting for protein levels complement activity measurements .
-
In vitro enzyme assays: Using recombinant Fads1 to measure conversion of radiolabeled or stable isotope-labeled substrates.
When reporting results, it is recommended to express hepatic fatty acid profiles in nmol/g tissue for standardization across studies .
What viral vector systems are most effective for Fads1 overexpression or knockdown in animal models?
Based on the research literature, several viral vector systems have proven effective for manipulating Fads1 expression in animal models:
-
For hepatocyte-specific overexpression:
-
AAV8 vectors have been successfully used to overexpress Fads1 specifically in hepatocytes .
-
These vectors can be administered via tail vein injection in rodents.
-
The effectiveness of delivery can be verified by detecting vector-specific sequences (like inverted terminal repeats, ITRs) in liver DNA using qPCR .
-
-
For knockdown experiments:
-
For in vitro studies prior to animal work:
The choice of vector depends on the specific research question, target tissue, desired duration of expression, and immune considerations. For liver-targeted studies, AAV8 is often preferred due to its strong hepatotropism, while lentiviral vectors provide stable integration for long-term expression studies.
How can researchers generate and validate antibodies against rat Fads1?
Generation and validation of antibodies against rat Fads1 involves several key steps:
-
Peptide selection: Choose peptide sequences that are specific to Fads1 and have good antigenic properties. Both N-terminal and C-terminal sequences can be targeted to generate antibodies against different regions of the protein .
-
Immunization protocol: A double-X 28-day protocol can be used, where rabbits are co-immunized with multiple peptides. These peptides should be coupled to carriers like Keyhole Limpet Hemocyanin to enhance immunogenicity .
-
Antibody purification: After immunization, antibodies can be purified from serum using affinity chromatography .
-
Validation steps:
-
Additional considerations:
-
Assess species cross-reactivity if the antibody will be used across different species
-
Determine suitability for different applications (Western blot, immunohistochemistry, immunoprecipitation)
-
Check antibody performance in different buffer conditions
-
For Western blotting applications, antibodies can be coupled to HRP-conjugated secondary antibodies, and detection performed using chemiluminescent methods. Proper loading controls (e.g., actin, GAPDH) should be included, though tissue-specific considerations are important as some loading controls may not be detectable in all tissues .
How should researchers interpret Fads1 activity data in the context of metabolic disorder studies?
When interpreting Fads1 activity data in metabolic disorder studies, researchers should consider several key factors:
-
Desaturation indices: The AA/DGLA ratio serves as the primary indicator of Fads1 activity . This ratio should be evaluated in multiple lipid pools (phospholipids, free fatty acids, total fatty acids) as the effects may differ between pools .
-
Dietary context: Different dietary conditions (e.g., high-fat, high-fructose vs. low-fat, high-fructose) can have varying effects on Fads1 activity . For example, research has shown that hepatic Fads1 activity is markedly reduced by high-fat, high-fructose diets compared to chow diets .
-
Tissue specificity: Fads1 activity may vary across tissues. When focusing on liver-specific effects, changes in hepatic Fads1 activity should be correlated with metabolic parameters such as insulin sensitivity, lipid accumulation, and inflammatory markers .
-
Intervention effects: When evaluating interventions like Fads1 overexpression, researchers should assess whether the intervention successfully rescues diet-induced reductions in Fads1 activity .
-
Statistical analysis: Linear models can be applied to estimate effects of various factors (sex, tissue type, interventions) and their interactions on Fads1 transcript levels and activity indices .
The table below summarizes how Fads1 activity (measured as AA/DGLA ratio) might be interpreted in different dietary contexts:
| Dietary Condition | Typical Fads1 Activity | Effect of Fads1 Overexpression | Metabolic Implications |
|---|---|---|---|
| Chow Diet | Normal baseline | Modest increase | Minimal additional benefit |
| Low-Fat, High-Fructose | Moderately reduced | Variable rescue | Potential metabolic improvement |
| High-Fat, High-Fructose | Markedly reduced | Significant rescue | Substantial metabolic improvement |
What are the key considerations for genetic colocalization analysis involving Fads1?
Genetic colocalization analysis is important for determining whether the same genetic variants influence both Fads1 expression and phenotypic outcomes. Key considerations include:
-
Bayesian colocalization methods: Tools like COLOC provide a statistical framework to assess the posterior probability (PP.H4) for a shared causal variant between Fads1 expression and the trait of interest. A PP.H4 > 70% is typically considered evidence for colocalization .
-
Linkage disequilibrium assessment: An approximate colocalization analysis can be performed by estimating the linkage disequilibrium (LD) r² between cis-eQTLs and trait-associated variants. An r² > 0.7 suggests approximate colocalization .
-
Potential for weak instrument bias: Instruments with F statistics < 10 may be subject to weak instrument bias, affecting the reliability of causal inference . This has been noted in tissues like hippocampus and substantia nigra for Fads1 expression .
-
Steiger filtering: This method should be applied to rule out potential reverse causality in Mendelian randomization analyses .
-
Multiple testing correction: When testing multiple tissues or cell types, appropriate correction for multiple testing (e.g., Benjamini-Hochberg method for FDR) should be applied .
-
Tissue and cell-type specificity: Fads1 expression effects may differ across tissues and cell types, making it important to consider tissue-specific eQTLs rather than using proxy SNPs .
By addressing these considerations, researchers can strengthen causal inference regarding the role of Fads1 in various traits and diseases, potentially identifying tissue-specific mechanisms and targets for intervention.
How is Fads1 genotype associated with cardiovascular conditions like aortic stenosis?
Recent research has identified associations between Fads1 genotype and aortic stenosis (AS), suggesting a potential mechanistic role for fatty acid metabolism in this cardiovascular condition:
-
Genome-wide association studies have found an association between Fads1 genotypes and fatty acid composition in plasma .
-
Variants within the Fads1 locus have been associated with Δ5 and Δ6 desaturase activity, measured by the ratios of arachidonic acid to dihomo-gamma-linolenic acid and gamma-linolenic acid to linolenic acid, respectively .
-
These desaturase activities have been linked to inflammation, type 2 diabetes mellitus, and coronary artery disease .
-
The Fads1 genotype rs174547 has been specifically studied in relation to aortic stenosis, with research examining its impact on mRNA expression, lipid profiles, and calcification in stenotic tricuspid aortic valves .
-
The association between Fads1 genotype and aortic stenosis suggests that alterations in valvular fatty acid composition may play a role in disease pathogenesis .
This emerging research direction connects genetic variation in fatty acid metabolism to structural and functional changes in the cardiovascular system, potentially opening new avenues for understanding the pathophysiology of aortic stenosis and identifying novel therapeutic targets.
What are the latest findings on Fads1 involvement in brain function and neurological disorders?
Research examining the relationship between Fads1 and neurological function has revealed several important findings:
-
Mendelian randomization studies have investigated the causal effects of Fads1 expression in multiple brain tissues (10 according to GTEx data) on cognitive function .
-
Cell type-specific analyses have examined Fads1 expression in specific brain cell populations and its relationship to cognitive outcomes .
-
Epidemiological studies have suggested associations between omega-3 fatty acids (which are influenced by Fads1 activity) and cognitive function .
-
The presence of tissue- and cell type-specific eQTLs for Fads1 in brain suggests potentially unique roles in different neural populations .
-
Some cis-eQTL instruments for Fads1 expression in hippocampus and substantia nigra have F statistics < 10, indicating potential weak instrument bias in these tissues and highlighting the need for cautious interpretation .
These findings suggest that Fads1, through its role in PUFA metabolism, may influence brain function and cognitive outcomes. The tissue- and cell type-specific effects emphasize the importance of considering neuroanatomical specificity when investigating Fads1 in neurological contexts. Further research is needed to elucidate the precise mechanisms by which Fads1-mediated fatty acid metabolism affects neural function and to determine whether targeting this pathway could have therapeutic potential in neurological and psychiatric disorders.
