Recombinant Rat Fatty acid desaturase 2 (Fads2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Rat FADS2 is produced by inserting the rat Fads2 gene into bacterial expression systems (e.g., E. coli), enabling large-scale purification for experimental use . Key functions include:

  • Δ6-Desaturase Activity: Introduces a double bond at the Δ6 position of fatty acid substrates, initiating PUFA synthesis .

  • Membrane Integration: Operates as a multi-pass endoplasmic reticulum membrane protein, requiring cytochrome b5 domains for electron transfer during catalysis .

  • Physiological Impact: PUFA products like arachidonic acid (AA) and eicosapentaenoic acid (EPA) influence inflammation, fertility, and cancer progression .

Production and Purification

Recombinant Rat FADS2 is typically expressed in E. coli with affinity tags (e.g., His-tag) for purification . Key parameters include:

ParameterDetails
Host SystemE. coli (e.g., BL21 strain)
Purity>90% by SDS-PAGE
FormLyophilized powder in PBS-based buffer with trehalose and DTT
Storage-80°C long-term; 4°C for short-term use
Reconstitution0.1–1.0 mg/mL in deionized water or PBS; 5–50% glycerol for stability

Research Applications

Recombinant Rat FADS2 is widely used to investigate:

  • Lipid Metabolism: Elucidates PUFA biosynthesis pathways and their regulation in rodents .

  • Disease Models: Studies link FADS2 dysregulation to cancer, infertility, and inflammatory disorders .

  • Drug Development: Screens for inhibitors targeting PUFA-driven tumor progression .

Experimental Findings

Recent studies highlight its functional versatility:

  • Knockout Effects: Fads2−/− mice exhibit infertility due to disrupted blood-testis barrier integrity and impaired spermatogenesis .

  • Substrate Flexibility: Rat FADS2 demonstrates activity toward multiple substrates, including 18:2n-6, 18:3n-3, and 16:0 .

  • Thermostability: Retains activity at 4°C for one week post-reconstitution, making it suitable for extended assays .

Comparative Insights

Rat FADS2 shares 85% sequence homology with human FADS2 but lacks Δ5-desaturase activity present in human isoforms . Unlike marine fish FADS2, it does not exhibit Δ4-desaturase activity, limiting its role in docosahexaenoic acid (DHA) synthesis .

Challenges and Future Directions

  • Activity Assays: Current recombinant forms require reconstitution into lipid membranes for in vitro activity measurements .

  • Therapeutic Potential: Engineering bifunctional Δ6/Δ5 FADS2 variants could enhance PUFA production for nutritional supplements .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents settle at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will select the tag type during production. If you have a specific tag preference, please specify it, and we will prioritize its implementation.
Synonyms
Fads2; Fadsd6; Acyl-CoA 6-desaturase; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase; Fatty acid desaturase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGKGGNQGEGSTELQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA EDMNLFKTNHLFFFLLLSHIIVMESIAWFILSYFGNGWIPTVITAFVLATSQAQAGWLQH DYGHLSVYKKSIWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIRRRDWVDLAWAI SYYARFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHIVMEIDLDHYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALLDIVSSLKKSGELWLDAYLHK
Uniprot No.

Target Background

Function
Fatty acid desaturase 2 (Fads2) plays a crucial role in the biosynthesis of highly unsaturated fatty acids (HUFA) from essential polyunsaturated fatty acids (PUFA) precursors, linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Acting as a fatty acyl-coenzyme A (CoA) desaturase, Fads2 introduces a cis double bond at carbon 6 of the fatty acyl chain. This enzyme catalyzes the initial and rate-limiting step in this pathway, converting LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n-3 series, Fads2 desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is further converted to docosahexaenoate (DHA)(22:6n-3), a vital lipid for nervous system function. Additionally, Fads2 can desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6, generating (6Z,11E)-octadecadienoate. Beyond its Delta-6 activity, this enzyme exhibits Delta-8 activity with a slight preference towards n-3 fatty acyl-CoA substrates.
Gene References Into Functions
  1. Our research demonstrated that both recombinant and native rat FADS2 were capable of Delta6-desaturating not only the cis9- but also the cis12- and cis15-18:1 isomers. PMID: 25701799
  2. Delta-6-desaturase connects polyunsaturated fatty acid metabolism with phospholipid remodeling and disease progression in heart failure. PMID: 24284026
  3. Epigenetic regulation of Fads2 may contribute to both short- and long-term regulation of PUFA synthesis. PMID: 23107313
  4. Fluctuations in progesterone and oestradiol during pregnancy potentially enhance the synthesis of LC PUFA through increased FADS2 expression. PMID: 22495065
  5. Our findings indicate that an imbalance of maternal micronutrients elevates Delta5 desaturase activity while reducing mRNA levels, and conversely, decreases Delta6 desaturase activity without affecting mRNA levels compared to control. PMID: 22133376
  6. Our results show that delta-6 desaturase, along with elongase-6 expression, was upregulated in 3-month-old Zucker fatty rats compared to their lean littermates. PMID: 21172452
  7. The regulation of 6-desaturase expression exhibits differences in female versus male liver (but not cerebral cortex) during n-3 fatty acid repletion. PMID: 19157821
  8. Delta6-desaturase acts on 24-carbon fatty acids in very-long-chain polyunsaturated fatty acid biosynthesis. PMID: 11988075
  9. Rat Delta 6-desaturase, which acts on 18- and 24-carbon fatty acids of the n-6 and n-3 series, can also catalyze palmitic acid Delta 6 -desaturation. PMID: 12562851
  10. n-6 and n-3 PUFAs suppressed hepatic Fads2 expression by inhibiting the rate of Fads2 gene transcription. In contrast, consumption of the PPARalpha activator WY 14,643 significantly enhanced hepatic DeFads2 transcription by 500%. PMID: 12562861
  11. Testicular distribution of Delta5- and Delta6-desaturase and stearoyl-CoA desaturase 1 and 2 indicates that all four desaturases appear to be localized in Sertoli cells, with significantly lower expression in germ cells. PMID: 12606372
  12. Utilizing 6-month-old eSS rats that had already developed insulin resistance, we investigated the changes induced on delta9, delta6, and delta5 liver desaturases. PMID: 14577661
  13. We observed a significant increase in delta 6-desaturase activity, while gene expression showed a tendency to decrease. PMID: 15589689

Show More

Hide All

Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the liver and brain (at protein level). Highest activity is found in the liver and adrenals followed by the testes and other organs, absent in adipose tissue.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.