Recombinant Rat Fatty acid desaturase 3 (Fads3)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

Recombinant Rat Fads3 demonstrates unique catalytic behavior distinct from Fads1/Fads2:

Δ13-Desaturase Activity

  • Converts trans-vaccenic acid (trans11-18:1) to trans11,cis13-conjugated linoleic acid (CLA) .

  • No Δ5-, Δ6-, or Δ9-desaturase activity observed in COS-7 cell models .

  • Knockdown in rat hepatocytes reduces Δ13-desaturation of trans-vaccenate by 50% .

Functional Comparisons

EnzymeActivityKey SubstratesCatalytic Product
Fads1Δ5-desaturation20:3n-6, 20:4n-3Arachidonic acid (20:4n-6)
Fads2Δ6-desaturation18:2n-6, 18:3n-3γ-linolenic acid (18:3n-6)
Fads3Δ13-desaturationtrans-vaccenic acid (trans11-18:1)trans11,cis13-CLA

Role in Lipid Metabolism

  • DHA Biosynthesis: Fads3 knockout (KO) mice exhibit reduced docosahexaenoic acid (DHA, 22:6n-3) in neonatal brains and elevated 22:5n-3/22:6n-3 ratios in liver, suggesting impaired DHA synthesis .

  • Gene Regulation:

    • Fads3 expression inversely correlates with Fads1/Fads2 in hepatic tissue .

    • Upregulated Elovl2/Elovl5 (elongases) in KO mice indicates compensatory mechanisms .

Tissue-Specific Isoforms

  • Three protein isoforms (75 kDa, 51 kDa, 37 kDa) show tissue-dependent expression in rats .

  • Human Fads3 displays distinct isoforms, suggesting evolutionary divergence .

Toxicological Interactions

  • Aryl hydrocarbon receptor (AHR) binds to the Fads3 promoter, and 2,3,7,8-tetrachlorodibenzodioxin (TCDD) modulates Fads3 expression, linking it to xenobiotic responses .

Recombinant Protein Detection

  • ELISA: Sensitivity of 0.056 ng/mL with a linear range of 0.156–10 ng/mL (Rat Fads3 ELISA Kit) .

  • Western Blot: Antibodies detect Fads3 in liver, spleen, and lung tissues .

Experimental Models

  • COS-7 Cells: Transient transfection confirms Δ13-desaturase activity .

  • Knockout Mice: Used to study Fads3’s role in PUFA metabolism and brain development .

Unresolved Questions and Future Directions

  • In Vivo Relevance: Δ13-desaturation observed in vitro but not consistently in vivo .

  • Isoform Functions: Biological roles of 75 kDa and 37 kDa isoforms remain unknown .

  • Regulatory Pathways: Mechanisms linking Fads3 to AHR and lipid homeostasis require further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference for customers.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Fads3; Fatty acid desaturase 3; Delta(13 fatty acid desaturase; Delta(13 desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Fads3
Target Protein Sequence
MGGVGEPGGGPGPREGPAPLGAPLPIFRWEQIRQHDLPGDKWLVIERRVYDISRWAQRHP GGSRLIGHHSAEDATDAFHAFHQDLHFVRKFLKPLLIGELAPEEPSQDGAQNAQLIEDFR ALRQAAEDMKLFEADTTFFALLLGHILAMELLAWLLVYLLGPGWVSSVLAALILAISQAQ CWCLQHDLGHASIFPKSRWNHVAQQFVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVT VAPVFLLGESSVEYGKKKRRYLPYNHQHLYFFLIGPPLLTLVNFEVENLAYMLVCMQWTD LLWAASFYSRFFLSYSPFYGATGTLLLFVAVRVLESHWFVWITQMNHIPKEIGHEKHRDW ASSQLAATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRHNYRRVAPLVKAFCAKHGLHYE VKPFLTALVDIIGSLKKSGDIWLDAYLHQ
Uniprot No.

Target Background

Function
Mammals possess diverse sphingoid bases that differ in their length and/or the pattern of desaturation and hydroxyl groups. The primary sphingoid base in mammalian ceramides is sphing-4-enine (sphingosine or SPH), which exhibits a trans desaturation at carbon 4. FADS3, a ceramide desaturase, introduces a cis double bond between carbon 14 and carbon 15 of the SPH-containing ceramides, resulting in the formation of sphinga-4,14-dienine-containing ceramides (SPD ceramides). SPD ceramides are widely distributed in mammalian tissues and cells. Due to their unique structure containing a cis double bond, SPD ceramides may play an opposite, negative role in lipid microdomain formation compared to conventional ceramides. FADS3 also acts as a methyl-end fatty acyl coenzyme A (CoA) desaturase, introducing a cis double bond between the preexisting double bond and the terminal methyl group of the fatty acyl chain. It desaturates (11E)-octadecenoate (trans-vaccenoate) at carbon 13, generating (11E,13Z)-octadecadienoate (also known as conjugated linoleic acid 11E,13Z-CLA).
Gene References Into Functions
  1. FADS3 was specifically secreted by hepatocytes within the extracellular matrix, where it was localized on fibronectin-containing fibers. The 51 kDa FADS3 is secreted into the extracellular matrix of hepatocytes and blood. PMID: 23966218
  2. FADS3 represents the first "methyl-end" fatty acid desaturase functionally characterized in mammals. PMID: 24070791
  3. FADS3 exists in multiple protein isoforms depending on the mammalian tissue. PMID: 19752397
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Essentially expressed in liver and kidney and to a lesser extent in heart, adipose tissue, stomach and pancreas (at protein level).

Q&A

What is the genomic structure of Fads3 and how does it relate to other Fads genes?

Fads3 belongs to the fatty acid desaturase (FADS) gene cluster, which includes Fads1 and Fads2. The Fads3 gene shows approximately 62% nucleotide sequence identity with Fads1 and 70% with Fads2. It was initially identified when Marquardt et al. described the human genomic structure of the FADS cluster in 2000. The gene has been integrated into gene expression analyses that have revealed its presence in various physiological contexts, including high expression at embryo implantation sites in mouse uterus .

What is the predicted protein structure of Fads3?

Fads3 is predicted to be a membrane-bound desaturase with a characteristic structure composed of two main domains: an N-terminal cytochrome b5-like domain and a C-terminal fatty acid desaturase domain. This structural arrangement is typical of front-end desaturases, similar to the structure of Fads1 and Fads2. These domains are considered potentially important for the regulation or catalytic function of the desaturase, as previously demonstrated for Fads2 .

How many protein isoforms of Fads3 exist in rats and how are they detected?

Research has revealed three potential protein isoforms of Fads3 in rats with approximate molecular weights of 75 kDa, 51 kDa, and 37 kDa. These isoforms can be detected using specific polyclonal antibodies directed against different regions of the protein. Two specific antibodies have been developed: anti-NtermFADS3 targeting the N-terminal sequence (31QIRQHDLPGDKWL) and anti-CtermFADS3 targeting the carboxyl-terminal sequence (352PKEIGHEKHRDWAS) of rat Fads3. A third antibody, anti-FADS2/3, has also been used due to its cross-reactivity with both rat recombinant Fads2 and Fads3. Protein detection is typically performed using Western blot analysis after SDS-PAGE or native PAGE, with chemiluminescent detection of HRP-conjugated secondary antibodies .

How does the mRNA expression of Fads3 compare with other Fads genes across tissues?

The tissue distribution of Fads3 transcripts differs significantly from that of Fads1 and Fads2. While Fads1 and Fads2 display similar mRNA profiles with highest transcript amounts in liver, kidney, brain, lung, and aorta, Fads3 mRNAs are predominantly found in lung, white adipose tissue, aorta, spleen, heart, and kidney. Statistical analysis has revealed a highly significant effect of sex, tissue, and their interaction on the mRNA levels of each Fads gene (P < 10^-5). Tissues like pancreas and skeletal and abdominal muscles show the lowest transcript levels of all Fads genes, while aorta, lung, and kidney consistently demonstrate high transcript levels for all three Fads genes .

Is there a correlation between Fads3 mRNA levels and protein expression?

Interestingly, the occurrence of Fads3 protein isoforms does not directly depend on the mRNA level as determined by real-time PCR. This suggests that post-transcriptional regulation may play a significant role in determining the expression of different Fads3 protein isoforms across tissues. This lack of correlation highlights the importance of assessing both mRNA and protein levels when studying Fads3 expression patterns .

How does Fads3 protein distribution vary across species?

While the three Fads3 protein isoforms (75 kDa, 51 kDa, and 37 kDa) are present in rat tissues, they show a different tissue distribution pattern in mouse tissues. Additionally, human cells and tissues exhibit distinct new isoforms of Fads3. This species-specific variation in Fads3 protein expression patterns suggests potential differences in function or regulation across mammalian species .

What protocols are used to clone and express recombinant rat Fads3?

The cloning of rat Fads3 begins with identifying the gene sequence through database searches and designing primers based on genomic data. The full-length coding sequence can be obtained through RACE (Rapid Amplification of cDNA Ends) reactions followed by PCR amplification from a tissue-specific cDNA library (such as rat liver).

The protocol involves:

  • Initial RACE reactions to identify the 5' end containing the start codon

  • Design of primers to amplify the full-length coding sequence

  • Nested PCR amplification with primers containing appropriate restriction sites

  • Cloning of the PCR product into an expression vector (such as pCMV/myc/cyto)

  • Verification of the correct sequence and in-frame orientation by DNA sequencing

For expression, the recombinant plasmid (e.g., pCMV/Fads3) is transiently transfected into mammalian cells like Cos-7 using electroporation. Cells are typically cultured for 48 hours post-transfection before protein extraction. Transfection efficiency can be assessed by β-galactosidase colorimetric assay after co-transfection with a reporter plasmid (pCMV- SPORT-βgal) .

How can Fads3 mRNA levels be quantified in tissue samples?

Quantification of Fads3 mRNA levels is typically performed using real-time PCR (qPCR). The protocol involves:

  • Total RNA extraction from tissue samples using reagents like Extract-All

  • Reverse transcription to generate cDNA

  • Design of specific primers targeting Fads3 and appropriate housekeeping genes

  • Amplification using real-time PCR with a fluorescent detection system

  • Data analysis using the comparative Ct method (2^-ΔΔCt)

  • Statistical analysis to evaluate differences between tissues and experimental conditions

This method allows for precise quantification of Fads3 transcript levels relative to reference genes, enabling comparison of expression patterns across different tissues and experimental conditions .

What methods are effective for Fads3 knockdown in primary cell cultures?

For functional studies of Fads3, RNA interference using small interfering RNA (siRNA) has proven effective for knockdown experiments in primary rat hepatocytes. The procedure involves:

  • Isolation of primary hepatocytes through in situ collagenase perfusion of rat liver

  • Transfection of cells with specific siRNA targeting Fads3 mRNA

  • Use of negative control siRNA targeting unrelated mRNA sequences as a comparison

  • Verification of knockdown efficiency by qPCR and Western blot analysis

  • Functional assays to assess the impact of Fads3 reduction on cellular processes

This approach allows researchers to specifically reduce Fads3 expression and observe the resulting phenotypic changes, providing insights into the functional role of the protein in native cellular contexts .

What is the enzymatic activity of Fads3 and how does it differ from other desaturases?

Unlike Fads1 and Fads2, which function as Δ5- and Δ6-desaturases respectively in polyunsaturated fatty acid biosynthesis, rat Fads3 displays a unique desaturase activity. Research has demonstrated that Fads3 does not possess common Δ5-, Δ6-, or Δ9-desaturase activities but instead catalyzes the unexpected Δ13-desaturation of trans-vaccenate (trans11-18:1). This activity represents the first characterized "methyl-end" fatty acid desaturase in mammals, challenging the conventional understanding that mammals lack desaturases capable of introducing double bonds at the methyl-end of fatty acids .

How can the desaturase activity of recombinant Fads3 be experimentally verified?

Verification of Fads3 desaturase activity involves transfection of expression cells (e.g., COS-7 cells) with recombinant Fads3, followed by substrate supplementation and product analysis. The experimental workflow includes:

  • Transfection of cells with rat Fads3 expression vector (control cells and cells expressing Fads1 or Fads2 serve as comparisons)

  • Confirmation of protein expression by immunoblot analysis

  • Incubation of cells with potential fatty acid substrates for 24 hours

  • Extraction of cellular lipids and preparation of fatty acid methyl esters (FAMEs)

  • Analysis of the FAME profile by gas chromatography-mass spectrometry (GC-MS)

  • Identification of newly formed desaturated products specific to Fads3-expressing cells

Using this approach, researchers have observed that cells expressing rat Fads2 can synthesize 18:4 n-3 from 18:3 n-3 (demonstrating Δ6-desaturase activity), while cells expressing Fads3 cannot perform this reaction but instead catalyze the Δ13-desaturation of trans-vaccenate .

What is the evidence that Fads3 functions as a Δ13-desaturase in native cellular contexts?

The evidence for Fads3 functioning as a Δ13-desaturase comes from both overexpression and knockdown experiments:

  • In overexpression studies with recombinant Fads3, the enzyme specifically catalyzes the conversion of trans-vaccenate to what is suggested to be trans11, cis13-CLA (a conjugated linoleic acid isomer)

  • In rat hepatocytes, knockdown of endogenous Fads3 expression using siRNA specifically reduces trans-vaccenate Δ13-desaturation

  • Structural characterization of the product strongly suggests it is the trans11, cis13-CLA isomer

These findings collectively indicate that Fads3 functions as a Δ13-desaturase in native cellular contexts, representing a previously unrecognized enzymatic activity in mammalian fatty acid metabolism .

What is the relationship between Fads3 and Fads2 in knockout models?

Studies using Fads2 knockout mice (Fads2 -/-) have revealed an interesting relationship between Fads3 and Fads2. In the liver of Fads2 -/- mice, enhanced mRNA expression of Fads3 has been observed. This upregulation suggests a potential compensatory mechanism where Fads3 may attempt to substitute for some functions of Fads2 when the latter is absent. The Fads2 gene deletion modifies enzymatic pathways of LC-PUFA biosynthesis and causes various pathologies without affecting the normal lifespan of the mice, indicating complex interrelationships between the Fads genes. This observation points to a possible functional connection between Fads3 and fatty acid metabolism pathways typically associated with Fads2 .

How do genetic polymorphisms in Fads3 correlate with lipid metabolism markers?

Multiple studies have identified significant correlations between single nucleotide polymorphisms (SNPs) in the Fads3 gene and various lipid metabolism markers. These associations include:

  • Variations in triglyceride levels

  • Alterations in HDL- and LDL-cholesterol plasma levels

  • Changes in plasma polyunsaturated fatty acid (PUFA) concentrations

These genetic correlation studies provide indirect evidence for Fads3's involvement in lipid and fatty acid homeostasis, suggesting that variation in Fads3 function may contribute to individual differences in lipid profiles and potentially influence disease risk factors related to lipid metabolism .

What is the potential physiological significance of Fads3's unique Δ13-desaturase activity?

The identification of Fads3 as the first methyl-end fatty acid desaturase in mammals has significant physiological implications. By catalyzing the Δ13-desaturation of trans-vaccenate to produce what appears to be trans11, cis13-CLA, Fads3 may play a role in the metabolism of dietary trans fatty acids. Trans-vaccenate is a major trans fatty acid found in dairy products and ruminant meat, and its conversion to CLA isomers may have implications for understanding the health effects of these dietary components.

This unique activity challenges the conventional understanding that mammals lack methyl-end desaturases and opens new avenues for research into:

  • The role of Fads3 in the metabolism of dietary trans fatty acids

  • Potential bioactive properties of trans11, cis13-CLA and related metabolites

  • The evolutionary significance of this enzymatic capability in mammals

  • Possible therapeutic implications for conditions involving altered lipid metabolism

The discovery of this unexpected enzymatic activity highlights how much remains to be learned about fatty acid metabolism in mammals and the specific contributions of Fads3 to these processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.