Recombinant Rat Frizzled-5 (Fzd5)

Shipped with Ice Packs
In Stock

Description

Neuronal Development

  • Polarity Regulation: Mouse Fzd5 localizes to axonal growth cones and regulates JNK-dependent neuronal polarization. Knockdown disrupts axonal marker distribution .

  • Synaptic Connectivity: Mediates Wnt-7a–induced synaptogenesis via non-canonical pathways .

Ocular Morphogenesis

  • Vitreous Vasculature: Conditional knockout in retinal cells causes persistent hyaloid vasculature and retinal detachment, mimicking human PHPV .

  • Lens Development: Germline deletion in mice results in rudimentary lens pits and optic cup malformations .

Immune Modulation

  • Activates inflammatory cytokine production in monocytes/macrophages via Wnt-5a signaling .

Recombinant Protein Applications

While rat-specific Fzd5 recombinant proteins are not commercially documented, mouse/human analogs (e.g., R&D Systems' 9060-FZ/1617-FZ) are used to:

  • Antagonize Wnt Signaling: Inhibit Wnt-3a–induced alkaline phosphatase activity (ED₅₀: 0.01–0.06 µg/ml) .

  • Study Receptor-Ligand Interactions: Fc-tagged proteins enable binding assays with Wnt ligands .

Research Limitations and Opportunities

  • Species-Specific Variance: Mouse Fzd5 regulates β-catenin–independent pathways in eye development, unlike zebrafish .

  • Unanswered Questions:

    • Rat-specific expression patterns in immune cells

    • Pharmacokinetic profiles of recombinant rat Fzd5 in disease models

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Fzd5; Frizzled-5; Fz-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-585
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFL CSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVL CMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPL YNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRY PERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFG MASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPV AGVCYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKL MIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGSDAGQPRAKPEYWVLMLK YFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMVAGDYAEASAALTGR TGPPGPAAAYHKQVSLSHV
Uniprot No.

Target Background

Function
Frizzled-5 (Fzd5) is a receptor for Wnt proteins. It can activate WNT2, WNT10B, and WNT5A, but not WNT2B or WNT4 (in vitro); the in vivo situation may differ as not all of these are known to be coexpressed. In neurons, activation of WNT7A promotes synapse formation. Fzd5 functions in the canonical Wnt/beta-catenin signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed for some family members, but it remains unclear if it represents a distinct pathway or if it can be integrated into the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways appear to involve interactions with G-proteins. Fzd5 may play a role in the transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Additionally, it is involved in yolk sac angiogenesis and placental vascularization.
Gene References Into Functions
  1. MicroRNA-216b was overexpressed in diabetic myocardial microvascular endothelial cells and its downregulation may actively enhance angiogenesis in diabetic angiopathy through inverse regulation on FZD5. PMID: 29477872
  2. Fzd5 plays a role in the establishment of neuronal polarity, and in the morphogenesis of neuronal processes. PMID: 24205342
  3. WNT7A can specifically act via a Frizzled-5.LRP6 receptor complex in PC12 cells and this activity can be antagonized by PMID: 12857724
Database Links

KEGG: rno:317674

UniGene: Rn.24792

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell junction, synapse. Perikaryon. Cell projection, dendrite. Cell projection, axon.

Q&A

What is Frizzled-5 (Fzd5) and what is its role in the Wnt signaling pathway?

Frizzled-5 is an approximately 62 kDa seven-transmembrane (7-TM) glycoprotein that functions as a receptor for Wnt proteins in the Wnt signaling pathway . It consists of:

  • An extracellular domain (ECD) containing a cysteine-rich domain (CRD) that binds Wnt ligands

  • A seven-pass transmembrane domain

  • A cytoplasmic domain with a PDZ binding motif

Fzd5 primarily functions in the canonical Wnt/β-catenin signaling pathway, where it interacts with low-density lipoprotein receptor-related proteins (LRP-5 or LRP-6) as co-receptors to stabilize β-catenin, ultimately promoting gene transcription important in development and tissue maintenance . It can also signal through non-canonical pathways independently of LRPs .

Which Wnt ligands interact with Frizzled-5?

Frizzled-5 functions as a receptor for multiple Wnt ligands, with established interactions with:

  • Wnt-5a

  • Wnt-7a

  • Wnt-9b

  • Wnt-10b

  • Wnt-2b

These interactions have been demonstrated through functional studies, with different Wnt ligands potentially triggering distinct downstream signaling cascades depending on cellular context and co-receptor availability . The binding affinity varies between different Wnt-Fzd5 pairings, which may contribute to the specificity of developmental and physiological outcomes.

What are the key domains in recombinant Fzd5 proteins?

Recombinant Frizzled-5 proteins typically feature the following key structural elements:

DomainFunctionAmino Acid Position (Human)
Signal peptideDirects protein to secretory pathwayN-terminal region
Cysteine-rich domain (CRD)Primary Wnt-binding regionWithin extracellular domain
Extracellular domain (ECD)Contains CRD and linker regionAla27-Pro167/Trp238 (varies by construct)
Seven-transmembrane domainSignal transductionCentral portion of protein
Cytoplasmic tailIntracellular signaling, contains PDZ binding motifC-terminal region

Most commercially available recombinant Fzd5 proteins are chimeric constructs containing the extracellular domain fused to an Fc tag to facilitate purification and detection .

Where is Frizzled-5 expressed during development and in adult tissues?

Frizzled-5 exhibits a distinct expression pattern that varies across developmental stages and tissue types:

Embryonic Expression:

  • Telencephalon

  • Pituitary

  • Thalamus

  • Hypothalamus

  • Eye (particularly distal optic vesicle and optic stalk)

  • Liver

  • Spleen

  • Lung

  • Kidney

  • Progenitor zone of the developing retina

Adult Expression:

  • Retina

  • Colon

  • Pancreatic islets

  • Certain cancer cell lines

  • Human embryonic stem cells

  • Specific monocyte and lymphocyte populations

This expression pattern suggests Fzd5's critical roles in the development and maintenance of neural structures, particularly the eye, as well as potential roles in immune function and tissue homeostasis .

How does Frizzled-5 expression differ between species?

While Frizzled-5 is highly conserved across vertebrates, its expression patterns and developmental functions show notable species-specific differences:

SpeciesDevelopmental RoleKey Expression SitesNotable Phenotypes in Loss-of-Function
MouseEye development, yolk sac angiogenesisPituitary, optic vesicle, retinal progenitor zoneDefects in optic cup morphogenesis, lens development, embryonic lethality due to yolk sac angiogenesis defects
ZebrafishEye and retina developmentSimilar to mouse, with strong expression in developing eyeEye and retina developmental defects
XenopusEye and retina developmentSimilar to mouse and zebrafishEye and retina developmental defects
RatNeuronal development, synaptic formationThalamus, developing retina, brain regionsSimilar to mouse, but with some species-specific timing differences

Interestingly, while Fzd5 is required for eye and retina development in zebrafish and Xenopus, conditional inactivation studies in mice suggest that its role may be compensated by other factors in mammalian eye development, highlighting important species-dependent functions .

How should recombinant Fzd5 proteins be reconstituted and stored for optimal activity?

Proper handling of recombinant Fzd5 is critical for maintaining functional activity:

Reconstitution Protocol:

  • Centrifuge the lyophilized protein briefly before opening the vial

  • Reconstitute at a concentration of 200 μg/mL in sterile PBS (pH 7.4)

  • Allow the protein to dissolve completely by gentle mixing; avoid vigorous shaking

  • After reconstitution, prepare aliquots to minimize freeze-thaw cycles

Storage Recommendations:

  • Store lyophilized protein at -20°C to -80°C

  • After reconstitution, store aliquots at -80°C for long-term storage

  • For short-term use (up to 1 month), store at 4°C

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Use a manual defrost freezer for storage

Activity of recombinant Fzd5 can be verified through binding assays with known Wnt ligands or through functional assays measuring canonical Wnt pathway activation.

What are the critical considerations when designing experiments with Frizzled-5 knockout or knockdown models?

When designing experiments involving Fzd5 manipulation, researchers should consider:

Developmental Timing:

  • Complete Fzd5 knockout in mice leads to embryonic lethality around E10.25 due to defects in yolk sac angiogenesis

  • Conditional knockout approaches using tissue-specific Cre lines (e.g., Six3-Cre for eye development) may bypass early lethality

Functional Redundancy:

  • Other Frizzled family members may compensate for Fzd5 loss in certain contexts

  • Conditional knockout studies in mice revealed no obvious early eye defects, suggesting potential compensation by other Frizzleds in mammals

Pathway Analysis:

  • Assess both canonical (β-catenin-dependent) and non-canonical Wnt signaling

  • Monitor Axin2 mRNA expression and TCF/LEF-responsive reporter activation to determine pathway effects

  • Studies indicate Fzd5 does not regulate the Wnt/β-catenin pathway in the eye, contradicting expectations based on its role in other tissues

Species Considerations:

  • Function appears to be species-dependent; findings from zebrafish or Xenopus may not translate to mammals

  • Design cross-species validation experiments when appropriate

How can I validate the specificity of recombinant Fzd5 in binding assays?

To ensure specificity in Fzd5 binding assays:

  • Positive Controls:

    • Include known Fzd5 ligands (Wnt-5a, Wnt-7a, Wnt-10b) as positive controls

    • Verify binding with multiple detection methods (e.g., ELISA, surface plasmon resonance)

  • Negative Controls:

    • Test non-Fzd5 binding Wnt ligands (e.g., Wnt4 has been shown not to interact with Fzd5)

    • Use unrelated proteins of similar size/structure to rule out non-specific binding

  • Competition Assays:

    • Perform displacement assays using unlabeled ligands to confirm binding site specificity

    • Use anti-Fzd5 antibodies that target the CRD to block specific interactions

  • Mutational Analysis:

    • Test binding with Fzd5 constructs containing point mutations in the CRD

    • Compare wild-type and mutant binding kinetics and affinities

For quantitative binding assays, recombinant human Frizzled-5 Fc chimera proteins have demonstrated dissociation constants (Kd) of <1.5 nM with their cognate Wnt ligands, providing a benchmark for binding affinity expectations .

What controls should be included when investigating Fzd5-mediated signaling pathways?

Robust experimental design for Fzd5 signaling studies should include:

Pathway-Specific Controls:

  • Positive controls: Known activators of canonical (e.g., GSK3β inhibitors) and non-canonical Wnt pathways

  • Negative controls: Pathway inhibitors (e.g., Dkk1 for canonical pathway)

Reporter Assays:

  • TCF/LEF reporters for canonical pathway activation

  • JNK or NFAT reporters for non-canonical pathway activation

  • Include both basal and stimulated conditions

Protein-Level Controls:

  • Monitor β-catenin stabilization/nuclear translocation

  • Assess phosphorylation of downstream effectors (e.g., LRP6, Dishevelled)

Gene Expression Controls:

  • Measure known Wnt target genes (e.g., Axin2, Cyclin D1)

  • Include housekeeping genes for normalization

Cell Type Considerations:

  • Test in multiple relevant cell types (e.g., neuronal, retinal, endothelial)

  • Compare primary cells vs. cell lines to account for context dependency

How do I interpret contradictory results between Fzd5 studies in different species?

When encountering species-dependent differences in Fzd5 function:

  • Examine Evolutionary Context:

    • Compare sequence homology in the functional domains (CRD, transmembrane, cytoplasmic)

    • Assess conservation of interaction partners and downstream effectors

    • Consider evolutionary divergence of developmental programs

  • Evaluate Experimental Approaches:

    • Compare knockout/knockdown methodologies (germline vs. conditional)

    • Assess timing of intervention relative to developmental windows

    • Examine genetic background effects

  • Consider Functional Redundancy:

    • Investigate expression patterns of other Frizzled family members

    • Perform co-expression analyses to identify potential compensatory mechanisms

    • Consider double or triple knockouts of related Frizzleds

  • Contextual Analysis:

    • Examine tissue-specific co-factors that may alter signaling outcomes

    • Consider differences in extracellular matrix components or tissue architecture

    • Analyze the presence of modulators like R-spondins or Norrin

For example, the mouse Fzd5 knockout shows severe eye developmental defects in germline knockouts but not in conditional knockouts using Six3-Cre, suggesting timing-dependent requirements or compensatory mechanisms . This contradicts expectations based on zebrafish and Xenopus studies, highlighting the importance of species-specific analyses.

What metrics should I use to quantify Fzd5-Wnt binding interactions?

For rigorous quantification of Fzd5-Wnt interactions:

Binding Kinetics Parameters:

  • Association rate constant (kon)

  • Dissociation rate constant (koff)

  • Equilibrium dissociation constant (Kd)

Recommended Techniques and Metrics:

  • Surface Plasmon Resonance (SPR):

    • Real-time binding kinetics

    • Affinity measurements (Kd typically <1.5 nM for strong interactions)

    • Association and dissociation rates

  • Isothermal Titration Calorimetry (ITC):

    • Thermodynamic parameters (ΔH, ΔS, ΔG)

    • Stoichiometry of binding

    • Direct measurement in solution

  • Microscale Thermophoresis (MST):

    • Kd determination in near-native conditions

    • Low sample consumption

    • Label-free options available

  • ELISA-Based Approaches:

    • EC50 values from dose-response curves

    • Relative binding affinities

    • High-throughput screening capability

When reporting binding data, include both the method and all relevant parameters (kon, koff, Kd) along with experimental conditions (temperature, buffer composition, protein concentrations) to enable proper interpretation and reproducibility.

How can I optimize Western blot detection of recombinant or endogenous Fzd5?

For successful Western blot detection of Fzd5:

Sample Preparation:

  • Include protease inhibitors to prevent degradation

  • For membrane proteins like Fzd5, use appropriate lysis buffers containing detergents (e.g., RIPA, NP-40)

  • Avoid boiling samples, as this can cause aggregation of transmembrane proteins; instead, heat at 37°C for 30 minutes

Gel and Transfer Optimization:

  • Use 8-10% gels for better resolution of the ~62 kDa Fzd5 protein

  • Consider wet transfer methods for transmembrane proteins

  • Use PVDF membranes rather than nitrocellulose for improved protein binding

Antibody Selection and Dilution:

  • Anti-Frizzled 5 antibodies typically work best at 1/500 dilution for Western blot

  • Select antibodies targeting the N-terminal region for detecting recombinant Fc-fusion proteins

  • Validate antibody specificity using positive controls (Fzd5-expressing cells) and negative controls (knockdown cells)

Signal Detection:

  • Use enhanced chemiluminescence with longer exposure times if signal is weak

  • Consider signal amplification systems for low-abundance detection

  • For quantification, ensure linearity of signal within the exposure range

Expected Molecular Weight:

  • Native Fzd5: ~62 kDa

  • Glycosylated forms: 65-70 kDa

  • Recombinant Fc fusion proteins: ~52-56 kDa apparent molecular mass

What are common pitfalls when studying Fzd5 in neuronal development and how can they be avoided?

When investigating Fzd5 in neuronal contexts:

Challenge 1: Timing-Dependent Effects

  • Problem: Fzd5 functions can vary dramatically across developmental windows

  • Solution: Implement temporally controlled manipulation (e.g., inducible Cre systems, timed drug administration)

  • Methodology: Use time-course experiments with frequent sampling to capture transient effects

Challenge 2: Cell-Type Heterogeneity

  • Problem: Neural tissues contain diverse cell populations with different Fzd5 functions

  • Solution: Use cell-type specific promoters for targeted manipulation

  • Methodology: Combine with single-cell approaches or FACS sorting for cell-type specific analysis

Challenge 3: Compensatory Mechanisms

  • Problem: Other Frizzled receptors may compensate for Fzd5 loss

  • Solution: Consider double or triple knockouts, or use dominant-negative approaches

  • Methodology: Monitor expression of other Frizzled family members after Fzd5 manipulation

Challenge 4: Pathway Crosstalk

  • Problem: Fzd5 interacts with multiple signaling pathways beyond canonical Wnt signaling

  • Solution: Simultaneously monitor multiple pathways (Wnt/β-catenin, PCP, Wnt/Ca²⁺)

  • Methodology: Use phospho-specific antibodies and pathway-specific reporters

Fzd5 is particularly important in neuronal contexts for mediating the synaptogenic effect of Wnt-7a, contributing to neuronal polarity development, and supporting neuronal survival in the thalamus. Research approaches should be tailored to these specific functions when designing neuronal studies .

What factors influence the reproducibility of recombinant Fzd5 protein activity in functional assays?

To ensure reproducible functional activity of recombinant Fzd5:

Protein Quality Factors:

  • Proper folding: Verify correct disulfide bond formation in the cysteine-rich domain

  • Glycosylation status: CHO-expressed proteins typically have mammalian-like glycosylation patterns important for function

  • Purity levels: Aim for >95% purity as determined by SDS-PAGE

  • Endotoxin levels: Maintain <1.0 EU per μg of protein to avoid confounding inflammatory effects

Experimental Design Considerations:

  • Storage and handling: Follow recommended reconstitution protocols and avoid freeze-thaw cycles

  • Working concentration: Establish dose-response relationships to determine optimal concentrations

  • Buffer compatibility: Test compatibility with assay buffers; consider carrier proteins if needed

  • Incubation time: Optimize exposure time for maximal response

Validation Approaches:

  • Functional validation: Confirm activity using established Wnt signaling reporter assays

  • Batch-to-batch testing: Characterize each new lot against a reference standard

  • Positive controls: Include known active Wnt proteins in parallel assays

  • Multi-parameter assessment: Measure multiple outcomes (e.g., β-catenin stabilization, target gene expression)

When troubleshooting assay variability, systematically test each variable (protein source, cell type, assay conditions) to identify the source of inconsistency.

What are the emerging roles of Fzd5 in immune function and how can this be studied experimentally?

Recent discoveries have revealed unexpected roles for Fzd5 in adaptive immunity:

Key Findings:

  • Fzd5 is expressed in monocyte and lymphocyte populations

  • Fzd5 signaling can induce production of inflammatory cytokines in macrophages and monocytes

  • WNT5A/Frizzled-5 signaling orchestrates adaptive immune responses to microbial stimulation

Experimental Approaches:

  • Cellular Models:

    • Primary immune cell isolation (monocytes, macrophages, dendritic cells)

    • Differentiation protocols for generating specific immune cell subtypes

    • Co-culture systems with pathogens or pathogen-associated molecular patterns

  • Functional Assays:

    • Cytokine production measurement (ELISA, flow cytometry)

    • Phagocytosis and bacterial killing assays

    • T-cell activation and proliferation assays

  • Signaling Analysis:

    • Phospho-flow cytometry for immune signaling pathways

    • Integration with canonical immune signaling (TLR, NF-κB pathways)

    • RNA-seq to identify transcriptional networks

  • In Vivo Models:

    • Conditional knockout in immune cell lineages

    • Infection models with immune challenge

    • Bone marrow chimeras to distinguish cell-intrinsic effects

Methodological Considerations:

  • Use endotoxin-free recombinant proteins to avoid confounding results

  • Include proper pathogen controls and sterile inflammatory stimuli

  • Consider timing of Wnt pathway activation relative to immune challenge

This emerging area represents a promising intersection between developmental biology and immunology, potentially yielding new therapeutic targets for immunomodulation .

What are the most pressing unanswered questions in Fzd5 research?

Despite significant advances, several fundamental questions about Fzd5 biology remain unanswered:

  • Structural Determinants of Specificity:

    • How does the Fzd5 structure determine selective binding to specific Wnt ligands?

    • What structural features enable discrimination between canonical and non-canonical pathway activation?

  • Species-Dependent Functions:

    • What molecular mechanisms explain the species-specific roles of Fzd5 in eye development?

    • How have the functions of Fzd5 evolved across vertebrate lineages?

  • Context-Dependent Signaling:

    • How do tissue-specific co-factors modify Fzd5 signaling outcomes?

    • What determines whether Fzd5 activates canonical versus non-canonical pathways?

  • Therapeutic Potential:

    • Can selective modulation of Fzd5 provide therapeutic benefits in cancer, inflammatory conditions, or developmental disorders?

    • What is the role of Fzd5 in tissue regeneration and repair?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.