Recombinant Rat Frizzled-8 (Fzd8)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Wnt Signaling

FZD8 acts as a receptor for Wnt proteins, forming complexes with LRP5/6 to activate β-catenin signaling, which regulates cell proliferation, migration, and differentiation . Key mechanistic insights include:

Canonical Pathway Regulation

  • β-Catenin Stabilization: FZD8 knockdown in renal cell carcinoma (RCC) reduces cytosolic β-catenin, downregulating downstream targets like Cyclin D1 and c-Myc .

  • EMT Modulation: Silencing FZD8 increases E-cadherin (epithelial marker) and decreases Snail/Vimentin (mesenchymal markers), inhibiting metastasis .

Non-Canonical Pathways

  • Interacts with RYK and ROR2 to influence planar cell polarity (PCP) and calcium flux pathways .

In Vitro Studies

  • Proliferation Assays: FZD8 shRNA reduces RCC cell viability by 40–60% (CCK-8 assay) .

  • Migration/Invasion: Transwell assays show FZD8 knockdown suppresses RCC cell migration by 50% .

In Vivo Models

ParameterControl GroupFZD8 Knockdown Group
Tumor Volume (mm³)450 ± 30220 ± 25
Tumor Weight (g)1.8 ± 0.20.9 ± 0.1

Therapeutic Implications

  • Cancer: FZD8 overexpression correlates with RCC progression; targeting it suppresses tumor growth in xenografts .

  • Kidney Function: FZD8 interacts with soluble (pro)renin receptor (sPRR) to enhance β-catenin activity in renal collecting ducts, influencing urine concentration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate special requirements for the product format. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the protein with your desired tag.
Synonyms
Fzd8; Frizzled-8; Fz-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-684
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
ASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFF LCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTL CMDYNRTDLTTAAPSPPRRLPPPQPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDTAAAP PSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQ DERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRL VAGHEKVACSGGAPGAGGAGGAGGAATAGAGAAGAGASSPGARGEYEELGAVEQHVRYET TGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPS VKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRI RSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCL RDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAVG AGAGGSGPGGGGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
Uniprot No.

Target Background

Function
Frizzled-8 (Fzd8) is a receptor for Wnt proteins. It acts as a component of the Wnt-Fzd-LRP5-LRP6 complex, which triggers beta-catenin signaling by inducing the aggregation of receptor-ligand complexes into ribosome-sized signalsomes. The beta-catenin canonical signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and the subsequent activation of Wnt target genes. Additionally, a second signaling pathway involving PKC and calcium fluxes has been observed for some family members. The precise relationship between this pathway and the canonical pathway is still under investigation. PKC appears to be essential for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Fzd8 may play a role in the transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. It also acts as a coreceptor alongside RYK for Wnt proteins, such as WNT1.
Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Golgi apparatus. Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Rat Frizzled-8 (Fzd8) and how does it function in Wnt signaling?

Rat Frizzled-8 is one of at least ten seven-transmembrane (7TM) glycoproteins belonging to the Frizzled family of Wnt receptors . These receptors are thought to be G-protein-coupled and play crucial roles in canonical Wnt signaling pathways . When Wnt ligands engage with Frizzled-8, and with low-density lipoprotein receptor-related proteins LRP-5 or LRP-6 acting as co-receptors, this interaction stabilizes β-catenin and promotes gene transcription essential for development and tissue maintenance .

In experimental settings, recombinant Frizzled-8 proteins can be produced with various tags (such as Fc chimeras or biotinylated variants) to facilitate research applications . The functionality of these recombinant proteins can be verified through binding assays, as demonstrated when Recombinant Human Frizzled-8 Fc Chimera showed binding to Wnt-3a with an ED50 of 0.5-3 μg/mL in binding assays .

How conserved is Rat Frizzled-8 compared to human and other species' orthologs?

Rat Frizzled-8 exhibits remarkable evolutionary conservation across species. Within amino acids 28-172, human Frizzled-8 shares 99% amino acid identity with rat Frizzled-8, indicating near-complete conservation in this critical region . This high degree of conservation extends to other mammals, with human Frizzled-8 also sharing 99% amino acid identity with mouse Frizzled-8 in the same region .

The conservation gradually decreases with evolutionary distance, with human Frizzled-8 sharing 90% amino acid identity with Xenopus and 85% with zebrafish Frizzled-8 . This extensive cross-species conservation suggests fundamental biological importance and allows for meaningful cross-species experimental approaches and translational research.

What is the structural composition of Rat Frizzled-8 protein?

Based on human Frizzled-8 data, which shares 99% amino acid identity with rat Frizzled-8 in critical regions, the protein structure comprises:

DomainAmino Acid PositionFunction
Signal peptide1-27Directs protein to secretory pathway
Extracellular domain (ECD)28-275Contains ligand binding regions
Cysteine-rich domain (CRD)30-151Primary Wnt binding region
Seven-transmembrane region276-605Membrane anchoring and signal transduction
C-terminal cytoplasmic domain606-694Contains PDZ binding motif for intracellular signaling

The cysteine-rich domain (CRD) is highly conserved among Frizzled family members and constitutes the primary binding site for Wnt ligands . The 7TM region allows for membrane anchoring and signal transduction, while the C-terminal domain with its PDZ binding motif facilitates intracellular signaling interactions .

Which Wnt ligands show preferential binding to Frizzled-8?

Frizzled-8 demonstrates selectivity in its interactions with different Wnt ligands. Notably, strong interactions have been documented between Frizzled-8 and Wnt-2. When Wnt-2 was co-expressed with various Frizzled receptors in 293T cells, Frizzled-8 showed the most dramatic response with TCF activity increasing by at least 25-fold over vector control . This substantially exceeded the responses seen with other Frizzled receptors tested in parallel .

Additionally, recombinant Frizzled-8 has demonstrated binding capabilities with:

  • Wnt-3a - Biotinylated Recombinant Human Frizzled-8 Fc Chimera binds to Recombinant Human Wnt-3a with an ED50 of 0.5-3 μg/mL

  • Wnt-5a - Binding demonstrated in functional ELISA assays

These differential binding preferences are important considerations when designing experiments targeting specific Wnt signaling pathways.

What methodological approaches are recommended for studying Frizzled-8 and Wnt ligand interactions?

Several methodological approaches have proven effective for investigating Frizzled-8 and Wnt ligand interactions:

TCF Reporter Assays

These assays measure the activation of TCF-dependent transcription following Wnt pathway activation. Implementation includes:

  • Co-transfection of cells with:

    • Frizzled-8 expression construct

    • Wnt ligand expression construct

    • TCF-responsive reporter construct

    • Control reporter for normalization

  • Analysis of reporter activation 24-48 hours post-transfection

This approach successfully demonstrated that Wnt-2 co-expression with Frizzled-8 increased TCF activity by 25-fold in 293T cells and 5-fold in A549 lung cancer cells compared to vector controls .

Functional ELISA

For direct binding assessments between recombinant proteins:

  • Immobilization of Wnt ligand (e.g., Wnt-3a at 1 μg/mL)

  • Incubation with varying concentrations of biotinylated Frizzled-8

  • Detection of binding using streptavidin-conjugated enzyme

  • Determination of binding parameters (ED50)

Using this method, Biotinylated Recombinant Human Frizzled-8 Fc Chimera was shown to bind Recombinant Human Wnt-3a with an ED50 of 0.5-3 μg/mL .

How can recombinant Rat Frizzled-8 be utilized in cancer research models?

Recombinant Frizzled-8 proteins offer multiple applications in cancer research:

Wnt Signaling Inhibition

The cysteine-rich domain (CRD) of recombinant Frizzled-8 can act as a decoy receptor to sequester Wnt ligands, thereby inhibiting Wnt signaling. This approach has been successfully employed to inhibit growth of teratocarcinomas . Implementation involves:

  • Administration of purified recombinant Frizzled-8 CRD to cancer models

  • Assessment of Wnt pathway inhibition through downstream markers

  • Evaluation of phenotypic effects on cancer growth and progression

Biomarker Analysis

Given that Frizzled-8 is upregulated in 42% of lung tumor samples compared to matched normal tissues, with 91% of these samples also showing Wnt-2 upregulation, recombinant Frizzled-8 can be used to develop detection methods for these biomarkers . Methods include:

  • Development of specific antibodies using recombinant Frizzled-8 as immunogen

  • Creation of detection assays for Frizzled-8/Wnt complexes in patient samples

  • Correlation of expression levels with clinical outcomes

What experimental challenges exist in studying Frizzled-8 heterodimeric interactions?

Studying Frizzled-8 heterodimeric interactions presents several experimental challenges that require specific methodological considerations:

Complex Formation Dynamics

Frizzleds can form homodimers or selective hetero-oligomers with other family members, involving both the transmembrane regions and possibly the CRD . Challenges include:

  • Distinguishing between constitutive and ligand-induced dimerization

  • Determining the stoichiometry of receptor complexes

  • Accounting for cellular context effects on oligomerization

Recommended approaches include:

  • Förster resonance energy transfer (FRET) between differentially tagged receptors

  • Co-immunoprecipitation with epitope-tagged constructs

  • Single-molecule imaging techniques

Co-receptor Interactions

Frizzled-8 functionality involves interactions with co-receptors such as LRP-5/6:

  • R-spondins interact with Frizzled-8 and LRP-6 to activate β-catenin signaling

  • IGFBP-4 and CTGF interact with Frizzled-8 to inhibit Wnt signaling

Experimental designs must account for these complex interaction networks by:

  • Including relevant co-receptors in reconstitution experiments

  • Using domain-specific mutants to map interaction sites

  • Employing proximity ligation assays to detect native complexes

What are the critical parameters for quality assessment of recombinant Rat Frizzled-8 preparations?

Quality assessment of recombinant Rat Frizzled-8 preparations should address several critical parameters:

Protein Purity and Integrity

High-quality preparations typically require:

  • Purity assessment by SDS-PAGE under reducing and non-reducing conditions

    • Human Frizzled-8 Fc Chimera typically shows bands at 53-63 kDa under reducing conditions and 110-130 kDa under non-reducing conditions

  • Mass spectrometry verification of:

    • Intact mass

    • Post-translational modifications

    • Disulfide bond formation, particularly in the cysteine-rich domain

Functional Activity

Functional validation through:

  • Binding assays with known ligands:

    • ED50 determination for Wnt-3a binding (typically 0.5-3 μg/mL for human Frizzled-8)

    • ED50 determination for Wnt-5a binding (approximately 7-28 ng/mL for human Frizzled-8)

  • Cell-based activity assays:

    • Inhibition of Wnt signaling in TCF reporter assays

    • Competition with endogenous receptors for ligand binding

Stability Assessment

Stability parameters to monitor include:

  • Thermal stability through differential scanning fluorimetry

  • Aggregation propensity using dynamic light scattering

  • Functional stability after freeze-thaw cycles and at different storage temperatures

How does Frizzled-8 expression correlate with cancer progression and what are the implications for therapeutic targeting?

Frizzled-8 expression shows significant correlations with cancer development and progression, providing insights for therapeutic targeting:

Expression Patterns in Cancer

Semi-quantitative RT-PCR analysis of lung cancer samples revealed:

  • Frizzled-8 up-regulation in 42% of 50 lung tumor samples compared to matched normal tissues

  • Among samples with Frizzled-8 up-regulation, 91% also showed Wnt-2 up-regulation (p<0.05)

  • This co-regulation pattern was observed across adenocarcinomas, squamous cell carcinomas, and large cell carcinomas

These findings suggest that Frizzled-8 up-regulation may be a significant event in lung cancer development, particularly in conjunction with Wnt-2 overexpression.

Therapeutic Targeting Approaches

Several strategies for targeting Frizzled-8 in cancer have shown promise:

  • Dominant negative Wnt-2 (dnhWnt-2) reduces tumor growth in colony formation assays and xenograft mouse models, likely by interfering with Frizzled-8 activation

  • Recombinant Frizzled-8 CRD has been used to block Wnt signaling and inhibit growth of teratocarcinomas

  • Bi-specific domain antibodies targeting LRP6 inhibit Wnt and R-spondin ligand-induced Wnt signaling and tumor growth, which may involve disruption of Frizzled-8/LRP6 complexes

  • Novel approaches like Norrin/Wnt surrogate antibodies that modulate Frizzled signaling have been investigated for conditions like retinopathy

What formulation and reconstitution protocols are recommended for recombinant Frizzled-8?

Proper handling of recombinant Frizzled-8 proteins is critical for maintaining functional activity:

Formulation

Commercial recombinant Frizzled-8 preparations are typically:

  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose

  • Available as carrier-free (CF) preparations or with bovine serum albumin (BSA) as a carrier protein

Formulation TypeRecommended Application
With BSA carrierCell/tissue culture, ELISA standards
Carrier-freeApplications where BSA may interfere

Reconstitution Protocol

For optimal results:

  • Reconstitute lyophilized protein at 500 μg/mL in PBS

  • Ensure complete dissolution by gentle agitation

  • For long-term storage, aliquot and store at recommended temperatures

  • Avoid repeated freeze-thaw cycles that may compromise protein integrity

How can specificity of Wnt-Frizzled-8 interactions be verified experimentally?

Verifying the specificity of Wnt-Frizzled-8 interactions requires multiple complementary approaches:

Comparative Receptor Analysis

The specificity of Wnt-2 for Frizzled-8 was demonstrated by:

  • Co-expressing Wnt-2 with multiple Frizzled receptors in the same cellular context

  • Measuring TCF-dependent transcriptional activation for each receptor

  • Observing that Frizzled-8 showed a 25-fold increase in activity, substantially higher than other receptors

This approach can be adapted for other Wnt ligands by maintaining consistent experimental conditions across receptor variants.

Competitive Binding Assays

To determine binding specificity:

  • Establish baseline binding of labeled Wnt ligand to recombinant Frizzled-8

  • Add increasing concentrations of unlabeled competitor ligands

  • Calculate IC50 values to rank binding affinities

  • Compare displacement profiles across different Wnt family members

Domain Mapping

To identify specific interaction regions:

  • Generate domain deletion or point mutation variants of Frizzled-8

  • Assess binding capability and functional activation

  • The cysteine-rich domain (CRD, aa 30-151) is known to be critical for Wnt binding

What analytical techniques are most effective for studying Frizzled-8 in complex tissue samples?

Analyzing Frizzled-8 expression and function in complex tissue samples requires specialized techniques:

Expression Analysis

For detecting Frizzled-8 in tissues:

  • Semi-quantitative RT-PCR successfully demonstrated Frizzled-8 up-regulation in 42% of lung tumor samples

  • Quantitative PCR with:

    • Carefully validated primers spanning exon junctions

    • Appropriate reference genes for normalization

    • Controls for tissue-specific expression patterns

  • Immunohistochemistry using:

    • Antibodies raised against recombinant Frizzled-8

    • Antigen retrieval optimization for membrane proteins

    • Validation using overexpression and knockout controls

Functional Analysis

For studying Frizzled-8 activity in tissues:

  • Proximity ligation assays to detect Frizzled-8 interactions with:

    • Wnt ligands

    • Co-receptors like LRP5/6

    • Downstream signaling components

  • Ex vivo tissue culture with:

    • Addition of recombinant Frizzled-8 CRD as a competitive inhibitor

    • Assessment of β-catenin nuclear localization

    • Measurement of target gene expression

How is Frizzled-8 implicated in resistance to anticancer therapies?

Frizzled-8 and Wnt signaling have been implicated in resistance mechanisms to various anticancer therapies:

Kinase Inhibitor Resistance

Evidence suggests Wnt pathway activation, potentially through Frizzled-8, may contribute to resistance against anticancer kinase inhibitors . This has been documented in:

  • Studies examining widespread potential for growth-factor-driven resistance to anticancer kinase inhibitors

  • Research investigating alternative signaling pathways activated during treatment resistance

  • Analyses of tumor samples before and after development of resistance

Therapeutic Implications

These findings suggest several therapeutic approaches:

  • Combination therapies targeting both kinase and Wnt signaling pathways

  • Use of recombinant Frizzled-8 CRD as a Wnt pathway inhibitor to overcome resistance

  • Development of specific antibodies targeting Frizzled-8 to block activation by Wnt ligands

  • Monitoring Frizzled-8 and Wnt expression as biomarkers for potential resistance

What roles does Frizzled-8 play in developmental processes and how can recombinant proteins help elucidate these functions?

Frizzled-8 has significant roles in developmental processes that can be investigated using recombinant proteins:

Developmental Expression

During mouse development, Frizzled-8 is expressed in tissues that are important for organizing the anterior-posterior axis . These patterns suggest roles in:

  • Embryonic patterning and axis formation

  • Tissue specification and differentiation

  • Organogenesis and morphogenesis

Research Applications of Recombinant Proteins

Recombinant Frizzled-8 proteins provide valuable tools for developmental studies:

  • As probes to map endogenous Wnt distribution in developing tissues

  • As competitive inhibitors to disrupt specific Wnt signaling events

  • For generating neutralizing antibodies to perform targeted pathway inhibition

  • In binding assays to identify developmental stage-specific ligands

Experimental Models

Developmental functions can be studied using:

  • Ex vivo embryo culture with recombinant protein addition

  • Tissue-specific conditional expression systems

  • Organoid models treated with recombinant Frizzled-8 proteins

  • Spatiotemporally controlled delivery systems for in vivo manipulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.