Recombinant Rat FUN14 domain-containing protein 1 (Fundc1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Fundc1; FUN14 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MASRNPPPQDYESDDESYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVT GWCAGFLFQKVGKLAATAVGGGFLLLQVASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNIIEEATDFIKQNIVISSGFVGGFLLGLAS
Uniprot No.

Target Background

Function
Activates hypoxia-induced mitophagy, a crucial mechanism for mitochondrial quality control.
Database Links
Protein Families
FUN14 family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is FUNDC1 and what is its basic structure?

FUNDC1 (FUN14 domain-containing protein 1) is an integral mitochondrial outer-membrane protein containing 155 amino acids in humans, with three transmembrane fragments. Its C-terminal extends into the membrane gap while the N-terminal (amino acids 1-50) is exposed in the cytoplasm . The protein contains a conserved sequence from Drosophila melanogaster to Homo sapiens and is widely expressed, particularly abundant in tissues with high energy demands such as the heart and skeletal muscles . FUNDC1 contains a specific LC3 interaction region (LIR) motif (Y18-E19-V20-L21) that preferentially interacts with LC3, which is critical for its function in mitophagy .

What are the primary cellular functions of FUNDC1?

FUNDC1 serves multiple critical functions in mitochondrial biology:

  • Mediates the formation of mitochondria-associated endoplasmic reticulum membranes (MAMs)

  • Acts as an activator of hypoxia-induced mitophagy by recruiting LC3 protein family to mitochondria

  • Regulates angiogenesis through intracellular Ca²⁺ communication and modulation of VEGFR2 expression

  • Recruits DRP1 to ER-mitochondria contact sites to facilitate mitochondrial fission during hypoxia

  • Plays a role in hepatic ferroptosis by interacting with glutathione peroxidase/GPX4

  • Interacts with FBXL2 to maintain mitochondrial integrity and Ca²⁺ homeostasis

How is the Recombinant Rat FUNDC1 protein typically stored and handled?

Recombinant Rat FUNDC1 requires specific storage and handling conditions for optimal stability:

Storage recommendations:

  • Lyophilized form: 12 months at -20°C/-80°C

  • Liquid form: 6 months at -20°C/-80°C

  • Working aliquots: Up to one week at 4°C

Reconstitution protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

What are the key phosphorylation sites of FUNDC1 and how do they regulate mitophagy?

FUNDC1 contains several critical phosphorylation sites that precisely regulate mitophagy:

Phosphorylation SiteModificationEffect on MitophagyMediators
Ser13DephosphorylationActivationPhosphatases
Tyr18DephosphorylationActivationPhosphatases
Ser17PhosphorylationActivationKinases
Lys119UbiquitinationActivationUbiquitin ligases

These post-translational modifications are essential for mediating FUNDC1's interaction with LC3 and subsequent mitophagy activation . The dephosphorylation of Ser13 and Tyr18 is particularly important during hypoxic conditions, enhancing FUNDC1's binding affinity for LC3 and promoting selective mitophagy of damaged mitochondria .

How does FUNDC1 facilitate mitochondrial fission through protein-protein interactions?

FUNDC1 orchestrates mitochondrial fission through a sophisticated mechanism involving multiple protein interactions:

  • Under normal conditions, FUNDC1 interacts with OPA1 (Optic Atrophy 1) at site K70

  • Under mitochondrial stress:

    • OPA1 is cleaved or degraded by YME1L (yeast mitochondrial escape 1-like) and OMA1 proteases

    • FUNDC1 and OPA1 dissociate

    • Dephosphorylated FUNDC1 recruits DNM1L (Dynamin-1-like protein, also known as DRP1) to mitochondria

    • This recruitment promotes DNM1L oligomerization and GTPase activity

    • The process culminates in mitochondrial fission

This mechanism represents a critical adaptor function of FUNDC1 in stress-induced mitochondrial dynamics .

What is the relationship between FUNDC1-mediated MAMs and angiogenesis?

FUNDC1 plays a crucial role in angiogenesis through its function in MAM formation:

  • VEGF (Vascular Endothelial Growth Factor) significantly increases MAM formation and MAM-related proteins, including FUNDC1, in endothelial cells

  • Endothelial cell-specific deletion of FUNDC1:

    • Disrupts MAM formation

    • Reduces VEGFR2 expression

    • Inhibits tube formation, spheroid-sprouting, and functional blood vessel formation both in vitro and in vivo

  • Mechanistically, increased MAM formation:

    • Elevates cytosolic Ca²⁺ levels

    • Promotes phosphorylation of serum response factor (SRF)

    • Enhances SRF binding to the VEGFR2 promoter

    • Results in increased VEGFR2 production and subsequent angiogenesis

This relationship makes FUNDC1 a potential therapeutic target for disorders characterized by defective angiogenesis .

What are the recommended approaches for assessing FUNDC1-mediated mitophagy in rat tissue samples?

For comprehensive assessment of FUNDC1-mediated mitophagy in rat tissue samples, researchers should employ multiple complementary techniques:

  • Transmission electron microscopy (TEM):

    • Fix samples with 2.5% glutaraldehyde in 0.1 M sodium phosphate (pH 7.4) overnight at 4°C

    • Process for Epon Araldite embedding

    • Prepare ultrathin sections (50 nm) using an ultramicrotome

    • Stain with uranyl acetate and lead citrate

    • Visualize using an electron microscope with high-resolution digital camera capabilities

  • Co-immunoprecipitation for protein interactions:

    • Lyse tissues in appropriate buffer containing protease inhibitors

    • Perform immunoprecipitation with anti-FUNDC1 antibodies

    • Analyze co-precipitating proteins (LC3, DNM1L, etc.) via Western blotting

  • Mitochondrial function assessment:

    • Isolate mitochondria from relevant tissues

    • Measure mitochondrial membrane potential (ΔΨm) using fluorescent dyes

    • Perform high-resolution respirometry with different substrates and inhibitors

  • Phosphorylation status analysis:

    • Use phospho-specific antibodies against Ser13, Tyr18, and Ser17 sites

    • Employ mass spectrometry for unbiased phosphorylation profiling

How can I effectively overexpress or silence FUNDC1 in primary rat cardiomyocytes?

For modulating FUNDC1 expression in primary rat cardiomyocytes:

Isolation of cardiomyocytes:

  • Perform enzymatic digestion of rat heart using liberase for approximately 20 min

  • Incrementally reintroduce extracellular Ca²⁺ to 1.20 mM over 30 min

  • Use isolated myocytes within 8 hours

Overexpression methods:

  • Adenoviral transfection:

    • Use adenovirus expressing FUNDC1 (e.g., pAdeno-MCMV-Fundc1-3Flag-P2A-EGFP)

    • Apply to isolated cardiomyocytes in appropriate culture conditions

    • Verify expression via Western blotting and immunofluorescence

Silencing methods:

  • siRNA transfection:

    • Design specific siRNAs targeting rat FUNDC1

    • Optimize transfection conditions for primary cardiomyocytes

    • Verify knockdown efficiency via qPCR and Western blotting

  • CRISPR/Cas9 gene editing:

    • Design appropriate guide RNAs targeting the FUNDC1 gene

    • Deliver using appropriate vectors for primary cardiomyocyte transfection

Important considerations:

  • Conduct experiments 24-72 hours post-transfection, depending on experimental objectives

  • Include appropriate controls (empty vector, scrambled siRNA)

  • Verify cell viability after transfection procedures

How does FUNDC1 contribute to cardiac pathophysiology in metabolic disorders?

FUNDC1 plays a crucial role in cardiac pathophysiology during metabolic disorders:

  • High-fat diet (HFD) models:

    • FUNDC1⁻/⁻ mice show exacerbated cardiac remodeling when subjected to HFD

    • Loss of FUNDC1 accentuates HFD-induced:

      • Functional cardiac anomalies

      • Mitochondrial abnormalities

      • Cellular death

      • Elevated IP3R3 (inositol 1,4,5-trisphosphate receptor type 3) levels

      • Ca²⁺ overload

  • Molecular interactions:

    • FUNDC1 interacts with FBXL2 (F-box and leucine-rich repeat protein 2)

    • This interaction governs mitochondrial Ca²⁺ homeostasis through degradation of IP3R3

    • Truncated mutants of F-box (Delta-F-box) disengage FBXL2 interaction with FUNDC1

    • FUNDC1 deficiency accelerates palmitic acid-induced degradation of FBXL2 and decelerates IP3R3 degradation

  • Therapeutic implications:

    • Activation or transfection of FBXL2 alleviates lipotoxicity-induced cardiac damage

    • Inhibition of IP3R3 provides cardioprotection

    • Disruption of FBXL2 localization sensitizes cardiac tissue to lipotoxicity

What research models are most effective for studying FUNDC1's role in hypoxia-induced mitophagy?

Several research models have proven effective for investigating FUNDC1's function in hypoxia-induced mitophagy:

  • In vitro models:

    • Primary cardiomyocytes exposed to hypoxic conditions (1-5% O₂)

    • H9C2 rat cardiomyoblast cell line with modulated FUNDC1 expression

    • Endothelial cells for studying angiogenesis aspects

  • Ex vivo models:

    • Isolated perfused rat hearts subjected to ischemia-reperfusion

    • Mitochondria isolated from rat tissues under hypoxic conditions

  • In vivo models:

    • FUNDC1⁻/⁻ knockout mice subjected to:

      • Myocardial infarction

      • Ischemia-reperfusion injury

      • Transverse aortic constriction (TAC)

    • Tissue-specific FUNDC1 knockout models (e.g., endothelial cell-specific deletion)

    • Exercise preconditioning models for studying cardioprotection

  • Assessment methods:

    • Mitochondrial morphology (TEM)

    • Mitochondrial function (respirometry)

    • Cell death markers

    • FUNDC1 phosphorylation status analysis

    • Protein-protein interaction studies (co-immunoprecipitation)

What are the optimal approaches for studying FUNDC1 protein-protein interactions?

Multiple complementary approaches should be employed to comprehensively study FUNDC1 protein-protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Lyse cells/tissues in appropriate buffers containing protease inhibitors

    • Perform IP with anti-FUNDC1 antibodies or tagged FUNDC1 constructs

    • Identify interacting partners via Western blotting or mass spectrometry

  • Mass spectrometry (MS)-based approaches:

    • Immunopurify FUNDC1 complexes

    • Analyze using liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Employ data-independent acquisition (DIA) for comprehensive protein identification

  • Structure-based protein interaction interface analysis:

    • Generate computational models of interaction interfaces

    • Create truncated mutants to identify binding domains

    • For example, truncated mutants of F-box (Delta-F-box) showed disengagement of FBXL2 interaction with FUNDC1

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity to FUNDC1

    • Particularly useful for identifying transient or weak interactions

  • Fluorescence-based interaction studies:

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Particularly useful for studying interactions in living cells

How can I differentiate between the roles of FUNDC1 in mitophagy versus its function in MAM formation?

Distinguishing between FUNDC1's dual roles requires specific experimental approaches:

  • Mutational analysis:

    • Create specific FUNDC1 mutants that selectively disrupt:

      • LIR motif (Y18-E19-V20-L21) to impair LC3 binding and mitophagy

      • Domains responsible for MAM formation

    • Express these mutants in FUNDC1-depleted cells and assess distinct functions

  • Subcellular localization studies:

    • Use immunofluorescence microscopy to visualize FUNDC1 localization

    • Quantify co-localization with:

      • Mitochondrial markers (e.g., TOM20)

      • ER markers (e.g., calreticulin)

      • MAM markers (e.g., FACL4)

      • Autophagosome markers (e.g., LC3)

  • Functional assays:

    • For mitophagy assessment:

      • Mitochondrial mass measurement

      • Mitophagy flux assays (mt-Keima, mito-QC)

      • Mitochondrial DNA content analysis

    • For MAM formation assessment:

      • ER-mitochondria contact site quantification

      • Ca²⁺ transfer between ER and mitochondria

      • VEGF-induced angiogenesis assays (tube formation, spheroid sprouting)

  • Temporal analysis:

    • Study time-dependent changes in FUNDC1's roles under specific stimuli

    • For example, VEGF treatment significantly increases MAM formation and MAM-related proteins, including FUNDC1

By employing these approaches systematically, researchers can delineate the specific contributions of FUNDC1 to these distinct but interconnected cellular processes.

What are the current challenges and opportunities in targeting FUNDC1 for therapeutic purposes?

Current research highlights several challenges and opportunities in FUNDC1-targeted therapeutics:

Challenges:

  • Context-dependent functions:

    • FUNDC1 exhibits tissue-specific and condition-specific roles

    • The same intervention may have opposite effects in different tissues or disease states

  • Dual roles in cellular processes:

    • FUNDC1 mediates both protective mitophagy and potential excessive mitophagy

    • Determining the optimal level of FUNDC1 modulation remains difficult

  • Delivery methods:

    • Targeting specific cell types (e.g., cardiomyocytes, endothelial cells)

    • Achieving spatiotemporal control of FUNDC1 modulation

Opportunities:

  • Cell-penetrating inhibitory peptides:

    • Peptides targeting FUNDC1-related MAM formation have shown promise

    • These peptides suppress downstream angiogenic genes and inhibit tumor angiogenesis

  • Post-translational modification targeting:

    • Modulating specific phosphorylation sites (Ser13, Tyr18, Ser17)

    • Targeting ubiquitination at Lys119 site

  • Exercise preconditioning (EP):

    • EP activates FUNDC1-mediated mitophagy

    • This approach could provide cardioprotection without pharmacological intervention

  • FBXL2 stimulators:

    • Compounds like BC-1258 (10 μg/ml) activate FBXL2

    • This activation alleviates lipotoxicity-induced cardiac damage

How might gene editing technologies advance our understanding of FUNDC1 function in different tissue types?

Advanced gene editing approaches offer promising avenues for FUNDC1 research:

  • CRISPR/Cas9 applications:

    • Tissue-specific knockout models:

      • Generate conditional FUNDC1 knockout in specific tissues

      • Compare phenotypes across different tissue types

      • Identify tissue-specific roles and compensatory mechanisms

    • Knockin of tagged versions:

      • Create endogenous fluorescent protein fusions

      • Enable live-cell visualization of FUNDC1 dynamics

      • Study protein trafficking and interactions in real-time

    • Point mutation studies:

      • Generate specific phosphorylation site mutants (S13A, Y18F, S17D)

      • Create LIR motif variants to study mitophagy specificity

      • Develop K70 mutants to investigate OPA1 interaction

  • Single-cell analysis integration:

    • Combine CRISPR editing with single-cell transcriptomics

    • Identify cell-type-specific responses to FUNDC1 modulation

    • Map heterogeneous cellular responses within tissues

  • Organoid and 3D culture systems:

    • Apply gene editing in cardiac or vascular organoids

    • Study FUNDC1 function in more physiologically relevant contexts

    • Assess impact on tissue architecture and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.