Recombinant Rat FXYD domain-containing ion transport regulator 5 (Fxyd5)

Shipped with Ice Packs
In Stock

Description

Introduction to FXYD5

FXYD5 is a type I membrane protein that belongs to the FXYD family, which in mammalian cells consists of seven members (FXYD1-7). All family members share a conserved F-X-Y-D motif in their transmembrane domain and interact with Na+/K+-ATPase to affect its kinetic properties in a tissue-specific manner . In rats, the FXYD5 gene is identified by the gene ID 60338 and produces a protein with the UniProt ID P59647 .

The protein was initially identified as a cell surface molecule by a monoclonal antibody that was developed to selectively recognize cancerous but not normal cells. Due to its observed effect of reducing cell-cell adhesion in transfected liver cancer cells, it was termed dysadherin . Other synonyms include RIC (Related to Ion Channel), as named in mouse studies . The approved human gene nomenclature for this family is "FXYD-domain containing ion transport regulator" .

Protein Structure

Unlike other FXYD family members, FXYD5 possesses an atypically long extracellular domain exceeding 140 amino acids, which includes a cleavable signal peptide . The protein contains a short intracellular C-terminal segment of only 15 amino acids, which is involved in interaction with Na+/K+-ATPase . This unique structural arrangement facilitates its dual role in modulating ion transport and cell adhesion.

Molecular Weight and Modifications

This variability in observed molecular weight is attributed to extensive post-translational modifications, particularly of the N-terminal domain which has a high abundance of Serine, Threonine, and Proline residues . These modifications likely play important roles in regulating the protein's function and interactions.

Expression and Purification

Recombinant Rat FXYD5 is typically produced in mammalian expression systems to ensure proper folding and post-translational modifications. Commercial preparations of recombinant rat FXYD5 are expressed and purified from Human Embryonic Kidney 293 (HEK293) cells . This expression system allows for appropriate glycosylation and processing of the protein, which is crucial for maintaining its native structure and function.

Tagged Variants

Recombinant rat FXYD5 is available with various tags to facilitate purification and detection. Common configurations include His-tagged, Fc-fusion, and Avi-tagged systems . For instance, commercially available recombinant rat FXYD5 with His(Fc)-Avi tag enables efficient purification while preserving the protein's functional properties .

Modulation of Na+/K+-ATPase Activity

The primary known function of FXYD5, like other FXYD family members, is to interact with Na+/K+-ATPase and modulate its kinetic properties . This interaction has significant implications for cellular ion homeostasis and membrane potential.

Studies utilizing recombinant FXYD5 have demonstrated that it significantly affects Na+/K+-ATPase activity by:

  • Increasing the pump activity (Vmax) by more than two-fold, as measured by ouabain-blockable and K+-induced outward current or ouabain-inhibitable 86Rb+ uptake

  • Elevating the apparent affinity for Na+ approximately two-fold

  • Decreasing the apparent affinity for K+ by about 60%

These effects are mediated primarily through the transmembrane segment of FXYD5, as demonstrated through FXYD5-FXYD4 chimera studies . Importantly, FXYD5 increases the turnover rate of the pump without altering its plasma membrane expression levels, as confirmed by surface biotinylation experiments .

Cellular Adhesion and Morphology Regulation

Beyond its role in ion transport regulation, FXYD5 has significant effects on cellular adhesion and morphology:

  • It reduces cell-cell adhesion, partly by downregulating E-cadherin

  • It impairs adhesion of cells to the extracellular matrix, as observed by the reduced rate of cell transformation from spherical to flatter elongated shapes

  • It inhibits anterior-posterior polarity development in cells

  • It reduces the number of focal adhesion points, demonstrated by differential immunostaining of paxillin, a focal adhesion-associated adaptor protein

  • It affects the organization of actin fiber structure

These effects on cell adhesion are consistent across various cell types, making them robust indicators of FXYD5 activity .

Other Physiological Functions

FXYD5 has been implicated in several other physiological processes:

  • Upregulation of chemokine production

  • Modification of the glycosylation state of the Na+/K+-ATPase β1 subunit

  • Effects on cell migration, which interestingly can be either stimulatory or inhibitory depending on the cell type

Tissue Distribution

FXYD5 is expressed in a variety of cell types, with particularly high expression in epithelial tissues . Studies have shown that FXYD5 is especially abundant in:

  • Intestine

  • Spleen

  • Lung

  • Kidney

The protein is expressed to a much lesser extent in muscle tissues . Additional studies have also identified FXYD5 in endothelial cells and lymphocytes, though the physiological significance of its expression in the lymphatic system remains to be determined .

It's worth noting that in tissues composed of various cell types, such as muscle tissue, FXYD5 expression could be compartmentalized to specific cell populations, such as endothelial cells that are part of the vascular supply to muscle bundles .

Expression in Disease States

FXYD5 expression is significantly altered in various disease states, most notably in cancer. The protein is upregulated in several carcinomas originating from epithelial cells , and this increased expression has been correlated with disease progression and poor prognosis.

In high-grade serous ovarian cancer (HGSOC), for example, FXYD5 is upregulated both at the molecular and protein level in patients with poor outcomes . The prognostic value of FXYD5 mRNA has been confirmed, showing overexpression in short-term compared to long-term survivors .

Cancer Progression and Metastasis

FXYD5 has been strongly linked to cancer progression through multiple mechanisms:

  • It promotes metastasis , likely through its effects on reducing cell adhesion

  • It contributes to tumor cell invasion by modifying cellular morphology and adhesion properties

  • It is associated with shorter survival in various cancer types

Prognostic Significance

Research has demonstrated the prognostic value of FXYD5 expression:

Potential Therapeutic Implications

The involvement of FXYD5 in cancer progression suggests its potential as a therapeutic target. Inhibiting FXYD5 expression or function might help reduce metastasis and improve cancer outcomes. Additionally, its role in modulating Na+/K+-ATPase activity indicates potential applications in disorders related to ion transport dysregulation.

Current Research Applications

Recombinant rat FXYD5 serves as a valuable tool in various research applications:

  • Structure-function studies of FXYD family proteins

  • Investigation of Na+/K+-ATPase regulation mechanisms

  • Exploration of cell adhesion and migration processes

  • Cancer biomarker development and validation

  • Drug discovery targeting FXYD5-mediated processes

Future Research Directions

Several areas warrant further investigation:

  • Detailed structural characterization of FXYD5's interaction with Na+/K+-ATPase

  • Exploration of tissue-specific functions in non-epithelial tissues

  • Investigation of the role of post-translational modifications in FXYD5 function

  • Elucidation of the mechanisms underlying FXYD5's variable effects on cell migration

  • Development of therapeutic strategies targeting FXYD5 in cancer

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Fxyd5; FXYD domain-containing ion transport regulator 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-178
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Fxyd5
Target Protein Sequence
QTPEKPRSSFTAHQSSVTTHVPVPDQTSPGVQTTPPIWTSEAGEATGSQTAAKTKTQQLTEMATANPVTDPGPLTSSEKGTPALSRIKSPSPPKGYMPPSYIENPLDPNENSPFYYDNTTLRKRGLLVAAVLFITGIIILTSGKCRQFSQLCLNRHR
Uniprot No.

Target Background

Gene References Into Functions
  1. FXYD5 may play a significant role in regulating blood pressure. PMID: 22085977
Database Links
Protein Families
FXYD family
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Spleen, lung, skeletal muscle, and testis.

Q&A

What is FXYD5 and what is its role in cellular physiology?

FXYD5, also known as dysadherin or RIC, is a single-span type I membrane protein belonging to the FXYD family. These proteins are characterized by a 35-amino acid signature sequence domain beginning with the PFXYD motif and containing 7 invariant and 6 highly conserved amino acids . FXYD5 functions primarily as a tissue-specific regulatory subunit of the Na+/K+-ATPase, but possesses uniquely diverse physiological functions compared to other family members .

In rat models, FXYD5 has been shown to regulate multiple cellular processes:

  • Fine-tuning ion transport through association with and modulation of Na+/K+-ATPase activity

  • Regulation of cell-cell junctions, particularly tight and adherent junctions

  • Mediation of inflammatory responses via the NF-κB pathway

  • Influence on cell migration and adhesion properties

  • Maintenance of epithelial barrier integrity

To investigate FXYD5's physiological roles, researchers typically employ gene silencing via RNA interference, as demonstrated in studies using AR42J cells , or overexpression using recombinant plasmids followed by functional assays that measure changes in Na+/K+-ATPase activity, inflammatory responses, and cellular morphology.

How does FXYD5 differ structurally from other members of the FXYD family?

FXYD5 possesses several unique structural features that distinguish it from the other six mammalian FXYD proteins:

  • It contains an unusually long extracellular N-terminal domain (approximately 160 amino acids), significantly longer than other FXYD family members

  • The extracellular domain undergoes extensive O-glycosylation, generating a heavily glycosylated form of 50-55 kDa in addition to the core protein of approximately 20 kDa

  • While all FXYD proteins interact with Na+/K+-ATPase, FXYD5 uniquely modifies the glycosylation state of the β1 subunit

Structure-function studies using FXYD5/FXYD4 chimeras have demonstrated that both the transmembrane and extracellular domains of FXYD5 are required for its effects on Na+/K+-ATPase β1 subunit glycosylation . Additionally, mutations in the transmembrane domain significantly affect FXYD5's interaction with Na+/K+-ATPase and its functional consequences .

What methodologies are effective for detecting FXYD5 expression in rat tissues?

Multiple complementary approaches should be employed for comprehensive FXYD5 detection:

1. Transcriptional analysis:

  • RT-qPCR using specific primers targeting rat FXYD5 mRNA

  • Microarray screening for comparative expression analysis

  • RNA-seq for comprehensive transcriptomic profiling

2. Protein detection:

  • Western blot analysis with consideration for glycosylation state

    • FXYD5 typically appears in two forms: a core ~20 kDa protein and a heavily glycosylated ~50-55 kDa form

    • Sample preparation methods significantly impact detection sensitivity

  • Immunohistochemistry and immunofluorescence for tissue localization

3. Expression validation:

  • Functional validation through Na+/K+-ATPase activity assays

  • In FXYD5 silencing experiments, verification by both RT-qPCR and Western blot is essential

In published research, FXYD5 silencing has been verified in AR42J cells using multiple siRNAs (si-FXYD5-1 and si-FXYD5-2), with si-FXYD5-2 showing greater efficacy, reducing FXYD5 expression to approximately 50% of control levels . Similarly, effective knockdown has been achieved in ATDC5 cells using shRNA clones (shFXYD5-1 and shFXYD5-2) .

How does FXYD5 regulate Na+/K+-ATPase activity in rat models?

FXYD5's regulation of Na+/K+-ATPase can be methodologically investigated through several experimental approaches revealing tissue-specific effects:

In renal tubular epithelial cells (RTECs):

  • Up-regulated FXYD5 mRNA expression enhances cell membrane Na+/K+-ATPase activity (P<0.05)

  • This increased activity correlates with enhanced cell proliferation (P<0.05)

In vascular smooth muscle cells (VSMCs):

  • Down-regulated FXYD5 expression inhibits membrane Na+/K+-ATPase activity (P<0.01)

  • This effect correlates with reduced cell migration (P<0.01)

The regulatory mechanisms involve:

  • Direct protein-protein interactions: Transmembrane domain mutations in FXYD5 (particularly at positions equivalent to CHIF residues 55 and 56) alter its interaction with Na+/K+-ATPase and consequently its functional effects

  • Indirect modification of pump properties: FXYD5 uniquely modifies the glycosylation state of the Na+/K+-ATPase β1 subunit, which affects the pump's plasma membrane localization, stability, and kinetic properties

This dual regulatory mechanism provides a molecular basis for FXYD5's tissue-specific effects on Na+/K+-ATPase function and downstream cellular processes.

What is the relationship between FXYD5 and inflammatory responses?

FXYD5 plays an essential role in mediating inflammatory responses in multiple rat tissue types:

In alveolar epithelial cells (AECs):

  • LPS exposure increases FXYD5 levels at the plasma membrane

  • FXYD5 silencing prevents both the activation of NF-κB and the secretion of cytokines in response to LPS

  • Overexpression of FXYD5 is sufficient to induce the NF-κB-dependent secretion of pro-inflammatory mediators including CCL2 and IL-6

In chondrocytes:

  • FXYD5 expression is significantly increased in LPS-treated cells

  • Knockdown of FXYD5 enhances cell viability and inhibits apoptosis in LPS-induced ATDC5 cells

  • FXYD5 silencing reverses LPS-induced ECM degradation by downregulating MMP3 and MMP13 while upregulating aggrecan and collagen II

In pancreatic acinar cells:

  • Cerulein induction significantly increases FXYD5 mRNA and protein expression

  • FXYD5 silencing inhibits inflammatory responses through blocking JAK2/STAT3 signaling pathway

FXYD5 is required for NF-κB activation downstream of multiple receptors, including TLR4 (LPS-mediated), IFNAR (IFN-α-mediated), and TNFR1 (TNF-α-mediated) , positioning it as a central mediator in diverse inflammatory signaling pathways.

What are the optimal conditions for expressing recombinant rat FXYD5?

Optimization of recombinant rat FXYD5 expression requires systematic evaluation across different expression systems:

1. Mammalian expression systems:

  • HEK293 or CHO cells are preferred for proper post-translational modifications

  • Successful expression has been achieved using the recombinant plasmid pcDNA3.1(+)-FXYD5 in renal tubular epithelial cells

  • Transient transfection with lipid-based reagents (e.g., Lipofectamine) shows good efficacy

  • For stable expression, selection with appropriate antibiotics followed by single-cell cloning improves homogeneity

2. Insect cell/Baculovirus expression:

  • Commercially available recombinant human FXYD5 is produced using baculovirus systems

  • This system may provide a balance between proper folding and post-translational modifications

Key methodological considerations:

  • Vector selection: Vectors containing strong promoters (CMV for mammalian cells)

  • Codon optimization: Adapting the rat FXYD5 sequence to the expression host

  • Signal sequence: Ensuring proper membrane targeting

  • Purification strategy: Incorporating affinity tags for downstream purification

  • Expression verification: Both protein detection (Western blot) and localization analysis (immunofluorescence)

For functional studies, verification of proper glycosylation is critical, as FXYD5's biological activity correlates with its post-translational modification state.

How can researchers effectively validate FXYD5 silencing in rat cell models?

Effective validation of FXYD5 silencing requires a multi-faceted approach:

1. Transcriptional validation:

  • RT-qPCR using specific primers for rat FXYD5

  • Published studies show significant downregulation of FXYD5 mRNA following siRNA transfection

2. Protein-level validation:

  • Western blot analysis demonstrates reduction in both core and glycosylated FXYD5 forms

  • In AR42J cells, different siRNAs showed variable efficacy:

    • si-FXYD5-2 reduced expression to approximately 50% of control levels

    • This was more effective than si-FXYD5-1

  • In ATDC5 cells, shFXYD5-2 showed greater silencing efficacy compared to shFXYD5-1

3. Functional validation:

  • Na+/K+-ATPase activity assays confirm altered pump function

  • Cell viability assessment demonstrates increased viability in several cell types following FXYD5 silencing:

    • In cerulein-induced AR42J cells, FXYD5 silencing significantly increased cell viability

    • In LPS-treated ATDC5 cells, FXYD5 knockdown reversed the decreased cell viability

  • Analysis of apoptosis markers shows decreased Bax and cleaved caspase-3 with increased Bcl-2 expression

  • Assessment of inflammatory pathway activation (NF-κB, JAK2/STAT3) confirms downstream effects

Critical methodological considerations:

  • Use multiple siRNA/shRNA sequences to rule out off-target effects

  • Include appropriate negative control siRNAs/shRNAs

  • Perform time-course analysis to determine optimal experimental timepoints

  • Consider rescue experiments with siRNA-resistant constructs for specificity confirmation

How does FXYD5 expression correlate with hypertension phenotypes in rat models?

FXYD5 shows a remarkable relationship with hypertension in rat models that has been methodologically investigated through multiple approaches:

Expression analysis in hypertensive models:

  • Microarray screening and RT-qPCR analysis revealed that FXYD5 mRNA expression is 14.8-fold lower in spontaneously hypertensive rats (SHRs) compared to normotensive Wistar-Kyoto (WKY) rats (P<0.01)

  • This substantial reduction suggests FXYD5 may play a protective role against hypertension development

Temporal expression patterns:

  • FXYD5 mRNA expression levels were highest in kidneys of 13-week-old SHR rats, precisely when blood pressure reached maximum levels

  • This temporal correlation suggests a potential compensatory mechanism attempting to counteract hypertension

Functional relevance:

  • In VSMCs, down-regulated FXYD5 expression inhibits cell migration and Na+/K+-ATPase activity

  • In RTECs, up-regulated FXYD5 expression enhances Na+/K+-ATPase activity and cell proliferation

These findings collectively suggest that FXYD5 may have significant impact on blood pressure regulation through:

  • Modulation of vascular smooth muscle cell function

  • Regulation of renal epithelial Na+/K+-ATPase activity

  • Influence on cell migration and proliferation in key tissues involved in blood pressure control

What glycosylation patterns characterize FXYD5 in different physiological states?

FXYD5 exhibits distinct glycosylation profiles that correlate with its functional state and can be methodologically investigated through several approaches:

Normal physiological state:

  • In normal rat tissues, FXYD5 is expressed primarily as a low molecular mass protein (~20 kDa) with minimal glycosylation

  • This represents the core protein form with limited post-translational modification

Inflammatory/pathological states:

  • After LPS instillation or in inflammatory conditions, a significant portion of FXYD5 becomes heavily O-glycosylated

  • This form appears as a 50-55 kDa protein on Western blots

  • The heavily glycosylated form predominantly localizes to the plasma membrane

Functional significance:

  • The glycosylated extracellular domain influences FXYD5's effects on Na+/K+-ATPase β1 subunit glycosylation

  • FXYD5-mediated modification of β1 glycosylation may interfere with the adhesive properties of Na+/K+-ATPase

  • This glycosylation shift correlates with FXYD5's inflammatory effects and may represent a regulatory mechanism

Experimental detection methods:

  • Western blot analysis with consideration for migration patterns

  • Glycosidase treatments (particularly O-glycosidases) to confirm glycosylation type

  • Lectin binding assays to characterize glycan structures

This glycosylation switch appears to be a critical regulatory mechanism controlling FXYD5's biological activities in different physiological contexts.

How does FXYD5 regulate immune cell recruitment in inflammatory models?

FXYD5 exhibits remarkable specificity in regulating immune cell recruitment during inflammation, as demonstrated through flow cytometry-based identification of leukocyte populations within lung tissue:

Cell type-specific recruitment patterns:

After overexpression of FXYD5 followed by LPS challenge, differential recruitment of myeloid populations was observed :

Immune Cell TypeEffect of FXYD5 OverexpressionSignificance
Interstitial macrophages (CD11b⁺MHCII⁺)Significantly increasedP<0.05
Classical monocytes (CD11b⁺MHCII⁻Ly6C⁺)Significantly increasedP<0.05
Eosinophils (SiglecF⁺CD11c⁻)IncreasedP<0.05
Neutrophils (Ly6G⁺CD11b⁻CD24⁻)No significant difference-
NK cells (NK1.1⁺CD11b⁺CD24⁺)No significant difference-
Alveolar macrophages (SiglecF⁺CD11c⁺)No significant difference-

Mechanistic insights:

  • FXYD5-induced recruitment is mediated primarily through CCL2-CCR2 signaling:

    • Treatment with anti-CCR2 antibodies decreases FXYD5-mediated cell recruitment

    • Similar effects are observed in CCR2-deficient mice

  • FXYD5 overexpression alone (without LPS) is sufficient to activate cytokine secretion in alveolar epithelial cells and increase cellular infiltration in bronchoalveolar lavage fluid

Methodology for investigating recruitment:

  • Flow cytometry using multiple surface markers for precise immune cell identification

  • Intratracheal administration of Ad-FXYD5 (72h prior to LPS challenge)

  • Antibody-mediated pathway inhibition studies

  • Genetic knockout models to confirm pathway specificity

This selective recruitment pattern suggests that FXYD5 induces secretion of specific chemokines that preferentially attract certain myeloid cell populations, with particular emphasis on monocyte-derived cells that express CCR2.

What are the key experimental differences between in vitro and in vivo FXYD5 studies?

Experimental approaches for studying rat FXYD5 differ significantly between in vitro and in vivo systems:

In vitro considerations:

  • Expression systems:

    • Cell lines: M1 kidney collecting duct cells , H1299 human lung carcinoma cells , AR42J pancreatic acinar cells , and ATDC5 chondrocytes have been successfully used

    • Transfection methods: Lipofectamine for transient expression, viral vectors for higher efficiency

  • Verification methods:

    • Western blot analysis for expression levels and glycosylation state

    • Immunofluorescence for subcellular localization

    • RT-qPCR for mRNA quantification

  • Functional readouts:

    • Na+/K+-ATPase activity assays

    • Cell viability and apoptosis assessment

    • Inflammatory marker expression

    • Cell migration and adhesion assays

In vivo considerations:

  • Delivery methods:

    • Adenoviral vectors (Ad-FXYD5) for tissue-specific expression

    • Intratracheal instillation for pulmonary studies

  • Experimental timeline:

    • 72h pre-treatment with Ad-FXYD5 before LPS challenge in pulmonary studies

  • Analysis methods:

    • Flow cytometry for immune cell recruitment analysis

    • Tissue homogenate analysis for Na+/K+-ATPase activity

    • ELISA for cytokine quantification in bronchoalveolar lavage fluid

    • Histological assessment of tissue morphology

Key differences and challenges:

  • Glycosylation patterns vary between systems, with in vivo inflammatory conditions promoting heavy O-glycosylation

  • In vitro studies allow precise molecular mechanistic investigation, while in vivo studies reveal systemic effects

  • Cell type-specific effects require validation across multiple systems

  • Translating molecular mechanisms from in vitro to in vivo requires careful experimental design

How do mutations in FXYD5 transmembrane domain affect its function?

Targeted mutations in the FXYD5 transmembrane domain provide critical insights into structure-function relationships:

Key mutational studies:

  • Exchanging the transmembrane domains of FXYD5 and CHIF (FXYD4) switched their apparent affinities for Na+/K+-ATPase

  • Mutation of FXYD5 residues at positions equivalent to CHIF residues 55 and 56 to Met and Ala respectively reversed the affinities of CHIF and FXYD5

  • Two point mutations in the transmembrane segment demonstrated that association of FXYD5 with the pump directly correlates with changes in cell morphology

Ser163 phosphorylation site:

  • The Ser163Asp mutation, which mimics phosphorylation, regulates FXYD5/Na+/K+-ATPase association

  • This interaction has been correlated with modulation of collective cell movement in epithelial cells

  • Unlike transmembrane mutations, the Ser163Asp mutation also interfered with plasma membrane localization of FXYD5

Experimental approaches:

  • Site-directed mutagenesis targeting specific residues

  • Domain swapping creating chimeric proteins

  • Phosphomimetic mutations to simulate phosphorylation states

  • Functional assays measuring Na+/K+-ATPase activity, cell morphology, and migration

These studies demonstrate that the transmembrane domain provides the primary interaction interface with Na+/K+-ATPase, while post-translational modifications of cytoplasmic residues regulate this association and subsequent functional effects.

What methodologies are effective for studying FXYD5 in inflammatory disease models?

Investigating FXYD5 in inflammatory diseases requires a comprehensive methodological toolkit:

1. Genetic manipulation approaches:

  • RNA interference:

    • siRNA transfection in AR42J cells effectively silences FXYD5 and inhibits inflammatory responses

    • shRNA approaches in ATDC5 cells (shFXYD5-1 and shFXYD5-2) successfully reduce FXYD5 expression

  • Overexpression systems:

    • Adenoviral vectors (Ad-FXYD5) for in vivo expression

    • Plasmid-based expression (pcDNA3.1(+)-FXYD5) for in vitro studies

2. Inflammatory induction models:

  • LPS exposure:

    • 5 μg/ml LPS treatment for 5h induces FXYD5 expression in chondrocytes

    • Intratracheal LPS instillation increases FXYD5 levels in the lung

  • Cerulein model:

    • Induces significant increase in FXYD5 mRNA and protein expression in pancreatic acinar cells

3. Pathway analysis techniques:

  • NF-κB pathway:

    • Western blot analysis for IκBα phosphorylation

    • NF-κB-responsive promoter activity assays

  • JAK2/STAT3 pathway:

    • Pathway manipulation using colivelin (CLN), a JAK2/STAT3 pathway agonist

    • Western blot analysis for phosphorylated pathway components

4. Functional readouts:

  • Inflammatory mediator production:

    • ELISA for CCL2, IL-6, and other cytokines in culture media or BALF

    • RT-qPCR for cytokine mRNA levels

  • Cellular responses:

    • Cell viability (CCK-8 assays)

    • Apoptosis markers (Bax, Bcl-2, cleaved caspase-3)

    • ECM component analysis (MMP3, MMP13, aggrecan, collagen II)

5. In vivo analysis:

  • Flow cytometry for immune cell population identification

  • Protein concentration in bronchoalveolar lavage fluid to assess barrier integrity

  • Selective antibody blocking (anti-CCR2) to determine pathway specificity

This comprehensive methodological approach enables systematic investigation of FXYD5's role across different inflammatory disease models.

How do researchers measure FXYD5's effects on cellular adhesion and junction integrity?

FXYD5's impact on cellular adhesion and junction integrity can be assessed through multiple complementary techniques:

1. Microscopic analysis:

  • Electron microscopy:

    • Reveals dilation of tight and adherent junctions

    • Shows expansion of interstitial spaces between neighboring cells

    • High magnification imaging captures subcellular junction alterations

  • Immunofluorescence microscopy:

    • Visualizes redistribution of junction markers

    • FXYD5 expression in polarized monolayers results in altered localization of:

      • Tight junction proteins: ZO-1 and occludin downregulated at membranes

      • Adherens junction proteins: β-catenin redistributed perpendicular to membrane plane

2. Functional barrier assessments:

  • Paracellular electrical resistance:

    • FXYD5-transfected M1 cells show reduced transepithelial electrical resistance

  • Macromolecule permeability:

    • Increased transcellular permeability to marker molecules

    • Quantifiable using fluorescent tracers of different molecular weights

3. Biochemical analysis:

  • Junction protein expression:

    • Western blot analysis of tight and adherent junction components

    • Assessment of Na+/K+-ATPase β1 subunit glycosylation status

    • FXYD5 expression correlates with reduced glycosylation of β1 subunit

4. Cell adhesion assays:

  • Cell attachment rate measurements:

    • Quantification of cell adhesion to extracellular matrix components

    • Time-course analysis of attachment strength

  • Cell-cell adhesion assessment:

    • Aggregation assays measuring multicellular cluster formation

    • Dispase-based dissociation assays quantifying resistance to mechanical stress

Through these methodologies, researchers have established that FXYD5 impairs cell-cell junction formation through:

  • Modification of Na+/K+-ATPase β1 subunit glycosylation

  • Disruption of transcellular β1-β1 interactions important for maintaining cell contacts

  • Alteration of tight junction protein distribution

  • Redistribution of adherens junction components

These effects collectively contribute to FXYD5's role in modulating epithelial barrier function in both physiological and pathological contexts.

How does FXYD5 research in rats translate to human disease applications?

Rat FXYD5 research offers valuable translational insights for human disease applications, with both similarities and differences requiring careful interpretation:

Shared molecular mechanisms:

  • Both rat and human FXYD5 modulate Na+/K+-ATPase activity through similar interactions

  • NF-κB pathway activation appears consistent across species

  • Inflammatory mediator production follows comparable patterns

  • Effects on cellular junctions and adhesion show mechanistic conservation

Disease-specific translation:

Disease ContextRat Model FindingsHuman Application Potential
HypertensionReduced FXYD5 expression (14.8-fold lower) in SHR rats correlates with hypertension development Potential target for anti-hypertensive therapy through modulation of Na+/K+-ATPase activity
Inflammatory diseasesFXYD5 mediates inflammatory responses in lung, joint, and pancreatic models Therapeutic target for inflammatory conditions including acute lung injury and pancreatitis
CancerLimited rat studies on cancer progressionHuman studies show FXYD5 overexpression correlates with worse prognosis across multiple cancer types

Methodological considerations for translational research:

  • Validation of findings across multiple model systems

  • Comparative expression analysis between rat and human tissues

  • Functional conservation studies using orthologous proteins

  • Development of targeted interventions based on conserved mechanisms

Emerging translational opportunities:

  • Development of FXYD5 inhibitors for anti-inflammatory applications

  • Prognostic biomarker potential in cancer and inflammatory diseases

  • Therapeutic targeting of FXYD5-Na+/K+-ATPase interaction

  • Modulation of FXYD5 expression or glycosylation as intervention strategy

What potential therapeutic applications exist for FXYD5 modulation?

Based on extensive rat model research, FXYD5 modulation presents several promising therapeutic avenues:

1. Anti-hypertensive applications:

  • FXYD5's significant reduction (14.8-fold) in spontaneously hypertensive rats suggests its role in blood pressure regulation

  • Therapeutic approach: Upregulation of FXYD5 expression or activity in vascular tissues

  • Target mechanism: Enhancement of Na+/K+-ATPase activity in vascular smooth muscle cells

  • Potential benefit: Improved blood pressure control through vascular tone modulation

2. Anti-inflammatory interventions:

  • FXYD5 silencing inhibits inflammatory responses across multiple tissue types:

    • Reduces NF-κB activation and cytokine production in lung epithelial cells

    • Decreases JAK2/STAT3 signaling in pancreatic acinar cells

    • Inhibits inflammation and ECM degradation in chondrocytes

  • Therapeutic approach: FXYD5 inhibition or silencing in inflammatory conditions

  • Target conditions: Acute lung injury, pancreatitis, inflammatory joint disease

3. Cancer therapy approaches:

  • FXYD5 (dysadherin) correlates with cancer progression and metastasis

  • Human studies show FXYD5 upregulation predicts shorter survival and promotes metastasis

  • Therapeutic approach: Inhibition of FXYD5 expression or disruption of its interactions

  • Target mechanism: Reduction of cancer cell migration and invasion

4. Targeted intervention strategies:

  • FXYD5-Na+/K+-ATPase interaction inhibitors

  • Glycosylation modulators affecting FXYD5 processing

  • Small molecule or peptide inhibitors of FXYD5's transmembrane domain

  • RNA interference approaches for tissue-specific silencing

Methodological considerations for therapeutic development:

  • Validation in multiple disease models with relevant endpoints

  • Investigation of potential side effects due to FXYD5's role in normal physiology

  • Development of tissue-specific delivery strategies

  • Assessment of effects on related FXYD family members

What are the most significant recent advances in FXYD5 research?

Recent advances in FXYD5 research have substantially expanded our understanding of this multifunctional protein:

1. Expanded role in inflammatory signaling:

  • FXYD5 has been identified as an essential mediator in the inflammatory response across multiple tissues

  • It functions as a required component for NF-κB activation downstream of diverse receptors including TLR4, IFNAR, and TNFR1

  • FXYD5 silencing inhibits inflammatory responses through multiple pathways, including JAK2/STAT3 signaling

2. Selective immune cell recruitment mechanisms:

  • FXYD5 overexpression specifically increases recruitment of interstitial macrophages and classical monocytes to inflamed tissues

  • This recruitment is primarily mediated through CCL2-CCR2 signaling

  • FXYD5 alone is sufficient to induce cytokine secretion and immune cell recruitment

3. Extracellular matrix regulation:

  • FXYD5 silencing reverses inflammatory ECM degradation by:

    • Downregulating matrix metalloproteinases (MMP3, MMP13)

    • Upregulating structural components (aggrecan, collagen II)

  • This positions FXYD5 as a regulator of tissue remodeling during inflammation

4. Structural insights into function:

  • The transmembrane domain provides the primary interaction interface with Na+/K+-ATPase

  • Phosphorylation of Ser163 regulates FXYD5/Na+/K+-ATPase association and subsequent cellular effects

  • Both transmembrane and extracellular domains are required for FXYD5's unique effects on Na+/K+-ATPase β1 subunit glycosylation

5. Disease-specific mechanisms:

  • In hypertension: 14.8-fold lower expression in SHR rats correlates with disease development

  • In inflammatory conditions: FXYD5 expression and glycosylation state shift significantly

  • In cancer: FXYD5 activates NF-κB pathway and promotes tumor growth and metastasis

These advances collectively establish FXYD5 as a multifunctional regulator at the intersection of ion transport, inflammatory signaling, cell adhesion, and tissue remodeling.

What are the key unanswered questions in FXYD5 research?

Despite significant progress, several critical questions remain in FXYD5 research:

1. Structural biology questions:

  • What is the three-dimensional structure of FXYD5, particularly its unusually long extracellular domain?

  • How does O-glycosylation pattern specifically affect FXYD5 function?

  • What is the precise structural basis for FXYD5's interaction with Na+/K+-ATPase?

2. Molecular mechanism questions:

  • Is FXYD5's effect on β1 subunit glycosylation direct or indirect?

  • What specific O-glycosylation sites are essential for FXYD5 function?

  • How do post-translational modifications regulate FXYD5 localization and activity?

  • How does FXYD5 simultaneously affect multiple signaling pathways (NF-κB, JAK2/STAT3)?

3. Physiological questions:

  • What controls the switch between low and high glycosylation states of FXYD5?

  • Why is FXYD5 expression reduced in hypertensive rats despite its apparent protective role?

  • How does FXYD5 mediate selective recruitment of specific immune cell populations?

  • What dictates the tissue-specific effects of FXYD5 on Na+/K+-ATPase function?

4. Pathological questions:

  • What is the causative role of FXYD5 in disease development versus compensatory responses?

  • How do FXYD5 polymorphisms or mutations contribute to disease susceptibility?

  • Can targeting FXYD5 provide therapeutic benefit in inflammatory or hypertensive conditions?

  • What is the relationship between FXYD5 glycosylation state and disease progression?

5. Translational questions:

  • What are the most effective approaches to modulate FXYD5 activity for therapeutic purposes?

  • How conserved are FXYD5 functions between rodent models and humans?

  • Can FXYD5 serve as a reliable biomarker for disease prognosis or treatment response?

  • What potential side effects might arise from therapeutic FXYD5 modulation?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.