Recombinant Rat G-protein coupled receptor 12 (Gpr12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr12; Gpcr12; G-protein coupled receptor 12; R334
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MNEDPKVNLSGLPRDCIEAGTPENISAAVPSQGSVVESEPELVVNPWDIVLCSSGTLICC ENAVVVLIIFHSPSLRAPMFLLIGSLALADLLAGLGLIINFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSTCLGLLPVMGWN CLRDESTCSVVRPLTKNNAAILSISFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGISTLALILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI YAFRNQEIQKALCLICCGCIPNTLSQRARSPSDV
Uniprot No.

Target Background

Function
Receptor with constitutive G(s) signaling activity that activates cyclic AMP. Promotes neurite outgrowth and inhibits myelin inhibition in neurons.
Gene References Into Functions
  1. These findings indicate that GPR12 may play a role in neurite outgrowth during PC12 cell differentiation. PMID: 21985983
  2. The cAMP levels required for maintaining meiotic arrest in mouse and rat oocytes are dependent on the expression of Gpr3 and/or Gpr12 PMID: 16229830
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the brain, pituitary gland and testis.

Q&A

What is G-protein coupled receptor 12 (Gpr12) and what are its primary functions?

Gpr12 is a G-protein coupled receptor with significant expression in the central nervous system and potential roles in both metabolic function and cellular processes. Current research indicates Gpr12 participates in cellular survival pathways, particularly through the ERK1/2 signaling cascade. Studies in Gpr12-deficient mice have demonstrated modest but significant effects on energy expenditure and food intake, suggesting metabolic regulatory functions . Additionally, Gpr12 has been implicated in cell survival mechanisms, with overexpression shown to inhibit apoptosis in certain cell types .

How does Rat Gpr12 compare structurally and functionally to human GPR12?

While the search results don't provide direct comparison data between rat and human GPR12, research indicates functional conservation across species. Similar to other G-protein coupled receptors, Gpr12 likely maintains structural homology while exhibiting species-specific variations in binding affinities and downstream signaling efficiency. In experimental models, GPR12 has demonstrated consistent roles in promoting cell survival across different species, particularly through ERK1/2 pathway activation . Researchers should consider potential species differences when translating findings between rat models and human applications.

What is known about Gpr12 tissue distribution in rats?

Gpr12 exhibits a unique brain distribution pattern that suggests involvement in emotionality and affect regulation. Studies with Gpr12-deficient mice have investigated this distribution, though no significant impacts on emotionality-related behaviors were detected in behavioral tests including light-dark box, tail suspension, and open field tests . Beyond neural tissues, Gpr12 expression has been documented in various cell types, with significant research interest in cancer cell lines where it may influence cell survival and proliferation .

What are the optimal conditions for expressing recombinant Rat Gpr12 in experimental systems?

For successful expression of recombinant Rat Gpr12, researchers should consider:

  • Vector Selection: Based on the literature, the pSin-EF2-Pur plasmid system has been used successfully for GPR12 overexpression. For cloning, restriction enzymes like SpeI and EcoRI are appropriate for linearization .

  • Cell Line Selection: HEK293T cells have demonstrated successful expression of GPR12 and are commonly used for initial expression testing .

  • Selection Method: Establishing stable expression typically requires antibiotic selection, with puromycin (0.5 mg/ml) for approximately 14 days being an effective protocol .

  • Verification: Western blot analysis should be employed to confirm successful expression and proper protein folding before proceeding with functional studies .

What are the most reliable methods for confirming Gpr12 knockdown or overexpression?

Based on published protocols:

  • For Knockdown Verification:

    • Western blot analysis provides quantitative protein expression confirmation

    • Short hairpin RNA (shRNA) cloned into hU6-MCS-CBh-gcGFP-IRES-puromycin lentiviral vectors has been successfully used for Gpr12 knockdown

    • Multiple shRNA constructs (e.g., shGPR12#1 and shGPR12#2) should be tested for effectiveness and specificity

  • For Overexpression Verification:

    • Western blot comparing expression levels to control/wild-type samples

    • Functional assays demonstrating expected cellular responses (e.g., reduced apoptosis rates)

    • Verification of downstream pathway activation (e.g., increased ERK1/2 phosphorylation)

How should researchers design experiments to investigate Gpr12 signaling pathways?

When investigating Gpr12 signaling pathways, researchers should implement multi-level analyses:

  • Pathway Component Analysis: Measure phosphorylation levels of key downstream effectors, particularly ERK1/2, as research has consistently demonstrated Gpr12's involvement in this pathway .

  • Rescue Experiments: Using pathway-specific activators (e.g., LM22B-10 for ERK1/2) to determine if they can reverse phenotypes observed in Gpr12 knockdown models .

  • Transcriptional Analysis: Differential gene expression analysis following Gpr12 modulation can identify target genes and enriched pathways. Previous research identified 548 differentially expressed genes (428 downregulated, 120 upregulated) between high and low GPR12 expression conditions .

  • Time-Course Studies: Monitoring the kinetics of pathway activation following Gpr12 stimulation can provide insights into direct versus secondary signaling effects.

How does Gpr12 modulation affect apoptotic pathways in different cell types?

GPR12 has significant effects on apoptotic regulation that vary by cell type:

  • In Epithelial Ovarian Cancer Cells:

    • GPR12 knockdown significantly increases Annexin V–positive cell populations

    • Knockdown increases protein levels of pro-apoptotic markers including BAX, cleaved caspase-3, and cleaved PARP

    • Decreases anti-apoptotic BCL-2 expression

    • These effects are mediated through reduced ERK1/2 phosphorylation

  • GPR12 Overexpression Effects:

    • Decreases cleaved PARP and cleaved caspase-3 protein levels

    • Increases BCL-2 protein expression

    • Significantly increases the BCL-2 to BAX ratio, a critical index for evaluating endogenous cell apoptosis

    • Increases ERK1/2 phosphorylation

This data suggests Gpr12 functions as a pro-survival factor by inhibiting intrinsic apoptotic pathways primarily through ERK1/2 signaling.

What metabolic phenotypes are associated with Gpr12 deficiency in animal models?

Gpr12-deficient mice exhibit subtle but significant metabolic alterations:

  • Energy Expenditure: A modest but statistically significant reduction in energy expenditure compared to wild-type littermates .

  • Food Intake: A trend toward lower food intake on standard chow diet, though this did not reach statistical significance in all studies .

  • Weight Regulation:

    • No significant differences in baseline body weight

    • No differences in body fatness

    • No differences in weight gain when subjected to high-fat diet

  • Other Metabolic Parameters:

    • No alterations in respiratory rate

    • No significant changes in other measured metabolic indicators

This pattern suggests Gpr12 plays a subtle regulatory role in energy homeostasis that may be compensated for by other mechanisms in knockout models.

What is the relationship between Gpr12 and the ERK1/2 signaling pathway in tumor progression?

The relationship between Gpr12 and ERK1/2 signaling in tumor progression is multi-faceted:

  • Pathway Activation: Gpr12 overexpression significantly increases ERK1/2 phosphorylation without altering total ERK1/2 levels, suggesting activation rather than expression modulation .

  • Functional Relevance:

    • ERK1/2 pathway activation via LM22B-10 can partially rescue the effects of Gpr12 knockdown

    • This includes reversing decreased cell viability and increased apoptosis in cancer cell lines

    • Demonstrates that ERK1/2 signaling is necessary for Gpr12's pro-survival effects

  • In Vivo Confirmation:

    • Tumor xenograft models show decreased phosphorylated ERK1/2 in Gpr12 knockdown tumors

    • This correlates with increased tumor necrosis and apoptosis

    • Smaller tumor volumes and weights in Gpr12 knockdown conditions

  • Bioinformatic Evidence:

    • Analysis of TCGA ovarian cancer data identified ERK1/2 cascade as significantly enriched in differentially expressed genes between high and low GPR12 expression samples

    • The relationship appears to be at the post-translational (phosphorylation) level rather than transcriptional regulation of pathway components

Conditionp-ERK1/2 StatusApoptotic MarkersTumor Growth
GPR12 KnockdownDecreasedIncreased cleaved caspase-3, cleaved PARP, BAXReduced
GPR12 OverexpressionIncreasedDecreased cleaved caspase-3, cleaved PARP, increased BCL-2Enhanced
GPR12 Knockdown + ERK1/2 ActivatorRescuedPartially normalizedPartially rescued

What are the recommended protocols for investigating Gpr12 function in vivo?

For robust in vivo investigation of Gpr12 function, researchers should consider:

  • Genetic Models:

    • Gpr12 knockout mice have been established and characterized for metabolic and behavioral phenotypes

    • Conditional knockouts may be valuable for tissue-specific function assessment

  • Xenograft Models:

    • Subcutaneous tumor xenograft models using 5 × 10^5 cells (e.g., SKOV3 cells) with Gpr12 modulation

    • Implantation into inguinal folds of nude mice

    • Monitoring should begin when tumors reach approximately 100 mm^3 (typically around 14 days post-implantation)

    • Parameters to assess include tumor volume, weight, and analysis of tumor tissue by various methods

  • Tissue Analysis:

    • Hematoxylin-Eosin (HE) staining for tumor necrosis assessment

    • TUNEL staining for quantifying apoptotic cells

    • Western blot analysis of tumor lysates for molecular markers (cleaved caspase-3, p-ERK1/2, t-ERK1/2)

  • Behavioral Assessments (if investigating neural functions):

    • Light-dark box test

    • Tail suspension test

    • Open field test

How should contradictory data on Gpr12 function be reconciled in research?

When encountering contradictory data on Gpr12 function, researchers should systematically address discrepancies through:

  • Context Consideration: GPR12 functions may be highly context-dependent. For example, while GPR12 shows strong effects on apoptotic regulation in cancer cells , Gpr12-deficient mice show only modest metabolic phenotypes and no behavioral changes . These differences likely reflect tissue-specific roles.

  • Methodology Analysis: Evaluate differences in:

    • Knockdown/knockout strategies (transient vs. stable, complete vs. partial)

    • Cell types or animal backgrounds used

    • Assay sensitivity and specificity

    • Time points examined (acute vs. chronic effects)

  • Compensatory Mechanisms: Consider that in knockout models, particularly whole-organism knockouts, compensatory mechanisms may mask phenotypes that would be apparent in acute knockdown models.

  • Signaling Context: Activation of ERK1/2 by GPR12 may have different outcomes depending on the cellular context and concurrent activation of other pathways.

  • Experimental Validation: When possible, test contradictory findings using multiple approaches within the same experimental system to identify methodological or biological sources of variation.

What are the optimal methods for analyzing Gpr12-mediated changes in gene expression?

For comprehensive analysis of Gpr12-mediated changes in gene expression:

  • RNA-Seq Approach:

    • Compare high versus low Gpr12 expression conditions

    • Use established differential expression analysis tools like "DEGSeq2" or "edgeR"

    • Previous analysis identified 548 differentially expressed genes (adjusted P < 0.05 and |logFC| ≥ 1) between high and low GPR12 expression groups

  • Enrichment Analysis:

    • Gene ontology (GO) and pathway enrichment analysis using tools like Metascape

    • Focus on significantly enriched terms such as "ERK1 and ERK2 cascade"

    • Previous analysis showed upregulated DEGs were enriched in "fatty acids", "antimicrobial humoral immune response", "NABA MATRISOME ASSOCIATED", "positive regulation of monocyte chemotaxis", and "ERK1 and ERK2 cascade"

  • Validation Strategies:

    • qRT-PCR validation of key differentially expressed genes

    • Western blot confirmation of protein-level changes

    • Functional assays testing the biological significance of identified pathways

  • Integration with Public Data:

    • Correlation analysis with datasets like TCGA to validate findings

    • Analysis of GPR12 expression correlation with key pathway components (e.g., MAP3K1, MAP2K1, MAP2K2, and MAPK1)

What are common challenges in generating stable Gpr12 expression systems and how can they be overcome?

Researchers may encounter several challenges when establishing stable Gpr12 expression systems:

  • Low Expression Levels:

    • Solution: Optimize codon usage for the host system

    • Use strong, cell-type appropriate promoters (e.g., EF2 promoter has been successful)

    • Consider inducible expression systems if constitutive expression affects cell viability

  • Protein Misfolding:

    • Solution: Include proper signal sequences and ensure appropriate post-translational modification capacity

    • Consider lower expression temperatures to facilitate proper folding

    • Verify functional activity through downstream signaling assays (e.g., ERK1/2 phosphorylation)

  • Selection Challenges:

    • Solution: Establish appropriate antibiotic concentration through kill curves

    • Maintain selection pressure (e.g., puromycin at 0.5 mg/ml) for at least 14 days

    • Use dual selection markers when possible

  • Verification Methods:

    • Solution: Confirm expression by Western blot

    • Validate functional activity through known downstream effects (e.g., changes in apoptotic markers or ERK1/2 phosphorylation)

How can researchers distinguish between direct and indirect effects of Gpr12 on observed phenotypes?

To differentiate between direct and indirect effects of Gpr12:

  • Temporal Analysis:

    • Examine the timing of events following Gpr12 activation or inhibition

    • Direct effects typically occur rapidly (minutes to hours)

    • Use time-course studies to establish sequence of events

  • Rescue Experiments:

    • Utilize pathway-specific activators or inhibitors (e.g., LM22B-10 for ERK1/2 activation)

    • If a phenotype is rescued by pathway modulation, it suggests that pathway is mediating the Gpr12 effect

  • Signaling Pathway Dissection:

    • Use specific inhibitors of different branches of potential downstream pathways

    • Monitor phosphorylation states of direct vs. secondary effectors

    • Utilize phosphoproteomic approaches for unbiased assessment

  • Genetic Approaches:

    • Create dual knockdown/knockout models targeting Gpr12 and potential mediators

    • Epistasis analysis can help establish pathway hierarchies

What are the best practices for analyzing Gpr12 effects in heterogeneous tissue samples?

When analyzing Gpr12 effects in heterogeneous tissues:

  • Cell Type Identification:

    • Use immunohistochemistry with cell-type specific markers alongside Gpr12 staining

    • Consider single-cell RNA sequencing to delineate cell-specific expression patterns

  • Micro-dissection Approaches:

    • Laser capture microdissection can isolate specific regions of interest

    • For tumor samples, separate analysis of tumor core vs. periphery may reveal context-dependent functions

  • In Situ Analysis:

    • TUNEL staining for apoptosis assessment in specific regions

    • Phospho-specific antibody staining for active signaling detection

  • Quantification Methods:

    • Develop clear scoring systems for histological analysis

    • Use digital image analysis when possible for objective quantification

    • For xenograft models, record multiple parameters including tumor volume, weight, and cellular composition

What are the most promising therapeutic applications of Gpr12 modulation based on current research?

Based on available research, the most promising therapeutic applications for Gpr12 modulation include:

  • Cancer Therapeutics:

    • GPR12 inhibition shows potential for treating epithelial ovarian cancer through promoting apoptosis

    • The significant reduction in tumor growth in xenograft models following GPR12 knockdown suggests clinical relevance

    • Targeting the GPR12-ERK1/2 axis represents a potential therapeutic strategy

  • Metabolic Disorders:

    • While effects are modest, Gpr12's involvement in energy expenditure suggests potential applications in metabolic disorders

    • Further research is needed to determine if Gpr12 modulation could have therapeutic effects in specific metabolic conditions

  • Biomarker Development:

    • GPR12 expression levels could serve as prognostic biomarkers in certain cancers

    • Research indicates GPR12 is highly expressed in epithelial ovarian cancer tissues and may predict patient prognosis

What complementary approaches should be considered alongside Gpr12 research?

To maximize research impact, investigators should consider these complementary approaches:

  • Integrated Pathway Analysis:

    • Investigate interactions between Gpr12 and other signaling pathways

    • Consider parallel pathways that might compensate for Gpr12 modulation

    • Explore synergistic targeting opportunities, particularly in the ERK1/2 cascade

  • Physiological Context:

    • Expand investigations beyond cancer and basic metabolic parameters

    • Consider Gpr12's unique brain distribution and potential neurological functions

    • Investigate potential roles in other physiological systems not yet explored

  • Structural Biology:

    • Determine Gpr12's three-dimensional structure to facilitate drug design

    • Identify binding sites for potential therapeutic agents

    • Develop selective Gpr12 modulators (agonists and antagonists)

  • Translational Models:

    • Develop models that better recapitulate human disease states

    • Consider patient-derived xenografts or organoids for cancer research

    • Investigate Gpr12 expression patterns in human tissue samples

How might environmental factors influence Gpr12 expression and function?

The influence of environmental factors on Gpr12 expression and function remains largely unexplored, but researchers should consider:

  • Dietary Influences:

    • Given Gpr12's modest effects on food intake and energy expenditure, dietary interventions may modulate its function

    • High-fat diet studies in Gpr12-deficient mice provide initial insights, though more targeted research is needed

  • Stress Responses:

    • Given its brain distribution, Gpr12 may be influenced by stress conditions

    • Investigate potential changes in expression or function under various stressors

  • Microenvironmental Factors:

    • For cancer research, tumor microenvironment factors may influence Gpr12 function

    • Hypoxia, inflammation, and other microenvironmental stressors may alter Gpr12 signaling

  • Developmental Timing:

    • Investigate potential developmental windows where Gpr12 function is particularly critical

    • Consider age-dependent changes in expression and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.